Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | TscAT/- |
Location | 392680..393194 | Replicon | chromosome |
Accession | NZ_CP113039 | ||
Organism | Staphylococcus aureus strain Gwen |
Toxin (Protein)
Gene name | TscT | Uniprot ID | A0A0H3K0C1 |
Locus tag | OS086_RS02190 | Protein ID | WP_001078344.1 |
Coordinates | 392680..393006 (-) | Length | 109 a.a. |
Antitoxin (Protein)
Gene name | TscA | Uniprot ID | - |
Locus tag | OS086_RS02195 | Protein ID | WP_223200634.1 |
Coordinates | 393009..393194 (-) | Length | 62 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OS086_RS02165 (387904) | 387904..388245 | - | 342 | WP_001190615.1 | hypothetical protein | - |
OS086_RS02170 (388695) | 388695..389336 | - | 642 | WP_001047698.1 | hypothetical protein | - |
OS086_RS02175 (389333) | 389333..389713 | - | 381 | WP_000356942.1 | hypothetical protein | - |
OS086_RS02180 (390023) | 390023..391732 | - | 1710 | Protein_398 | DUF927 domain-containing protein | - |
OS086_RS02185 (391746) | 391746..392615 | - | 870 | WP_001002689.1 | primase alpha helix C-terminal domain-containing protein | - |
OS086_RS02190 (392680) | 392680..393006 | - | 327 | WP_001078344.1 | DUF1474 family protein | Toxin |
OS086_RS02195 (393009) | 393009..393194 | - | 186 | WP_223200634.1 | pathogenicity island protein | Antitoxin |
OS086_RS02200 (393211) | 393211..393357 | - | 147 | WP_000784885.1 | hypothetical protein | - |
OS086_RS02205 (393354) | 393354..393671 | - | 318 | WP_000481967.1 | helix-turn-helix domain-containing protein | - |
OS086_RS02210 (393676) | 393676..393894 | - | 219 | WP_000153640.1 | helix-turn-helix transcriptional regulator | - |
OS086_RS02215 (394067) | 394067..394741 | + | 675 | WP_000620857.1 | helix-turn-helix transcriptional regulator | - |
OS086_RS02220 (394755) | 394755..395927 | + | 1173 | WP_000179343.1 | tyrosine-type recombinase/integrase | - |
OS086_RS02225 (395996) | 395996..397612 | - | 1617 | WP_000240642.1 | chaperonin GroEL | - |
OS086_RS02230 (397688) | 397688..397972 | - | 285 | WP_000917289.1 | co-chaperone GroES | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | scn / chp / sak / see / hlb / sell / sec / tsst-1 / groEL | 330182..397972 | 67790 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 12968.26 Da Isoelectric Point: 4.3050
>T265259 WP_001078344.1 NZ_CP113039:c393006-392680 [Staphylococcus aureus]
MNREIKDLFSDLKLLKDSFEDLKDSNGWHFDELYPYEPNHVLNKDELIGEGFSYHERRIHNNQMFDLFHLYIEQFDNIIE
KFYEIEKASSENFGEESDDAKNSIKVAE
MNREIKDLFSDLKLLKDSFEDLKDSNGWHFDELYPYEPNHVLNKDELIGEGFSYHERRIHNNQMFDLFHLYIEQFDNIIE
KFYEIEKASSENFGEESDDAKNSIKVAE
Download Length: 327 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|