Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 964296..964963 | Replicon | chromosome |
Accession | NZ_CP111004 | ||
Organism | Escherichia coli strain J53-p131 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | Q46953 |
Locus tag | ORI86_RS04695 | Protein ID | WP_001094400.1 |
Coordinates | 964296..964625 (-) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | P52141 |
Locus tag | ORI86_RS04700 | Protein ID | WP_000072690.1 |
Coordinates | 964646..964963 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORI86_RS04690 (959352) | 959352..963932 | + | 4581 | WP_010723187.1 | adhesin-like autotransporter YpjA/EhaD | - |
ORI86_RS04695 (964296) | 964296..964625 | - | 330 | WP_001094400.1 | type IV toxin-antitoxin system toxin YpjF | Toxin |
ORI86_RS04700 (964646) | 964646..964963 | - | 318 | WP_000072690.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
ORI86_RS04705 (965001) | 965001..965201 | - | 201 | WP_001395452.1 | DUF987 domain-containing protein | - |
ORI86_RS04710 (965210) | 965210..965692 | - | 483 | WP_001407480.1 | RadC family protein | - |
ORI86_RS04715 (965701) | 965701..966159 | - | 459 | WP_000211841.1 | antirestriction protein | - |
ORI86_RS04720 (966262) | 966262..966446 | - | 185 | Protein_919 | DUF905 family protein | - |
ORI86_RS04725 (967057) | 967057..968760 | - | 1704 | WP_000896263.1 | protein YfjW | - |
ORI86_RS04730 (968902) | 968902..969911 | + | 1010 | Protein_921 | arsenic transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 953306..986524 | 33218 | ||
- | flank | IS/Tn | - | - | 958097..959305 | 1208 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12308.21 Da Isoelectric Point: 7.2761
>T264748 WP_001094400.1 NZ_CP111004:c964625-964296 [Escherichia coli]
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A373F4I3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | P52141 |