Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 308306..308892 Replicon chromosome
Accession NZ_CP110931
Organism Salmonella enterica strain XM3104

Toxin (Protein)


Gene name doc Uniprot ID Q57IR9
Locus tag ORG44_RS01405 Protein ID WP_000174963.1
Coordinates 308524..308892 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID M7SDJ3
Locus tag ORG44_RS01400 Protein ID WP_001520924.1
Coordinates 308306..308527 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORG44_RS01375 (303333) 303333..304436 + 1104 WP_023235350.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
ORG44_RS01380 (304496) 304496..305422 + 927 WP_000003005.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
ORG44_RS01385 (305419) 305419..306696 + 1278 WP_001541045.1 branched chain amino acid ABC transporter permease LivM -
ORG44_RS01390 (306693) 306693..307460 + 768 WP_000082080.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
ORG44_RS01395 (307462) 307462..308175 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
ORG44_RS01400 (308306) 308306..308527 + 222 WP_001520924.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
ORG44_RS01405 (308524) 308524..308892 + 369 WP_000174963.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
ORG44_RS01410 (309151) 309151..310467 + 1317 WP_000624747.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
ORG44_RS01415 (310572) 310572..311459 + 888 WP_038394052.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
ORG44_RS01420 (311456) 311456..312301 + 846 WP_023235349.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
ORG44_RS01425 (312304) 312304..313374 + 1071 WP_011264401.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 305419..314111 8692


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-122)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13573.85 Da        Isoelectric Point: 6.7252

>T264493 WP_000174963.1 NZ_CP110931:308524-308892 [Salmonella enterica]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8152.14 Da        Isoelectric Point: 5.0775

>AT264493 WP_001520924.1 NZ_CP110931:308306-308527 [Salmonella enterica]
MRTVNYSEARQNLAEVLESAVTGGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5H6KCD5

Antitoxin

Source ID Structure
AlphaFold DB A0A6C6Z871

References