Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 1766477..1767063 | Replicon | chromosome |
| Accession | NZ_CP110657 | ||
| Organism | Salmonella enterica subsp. enterica strain S2122 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | E8XF70 |
| Locus tag | OOK64_RS08890 | Protein ID | WP_001521773.1 |
| Coordinates | 1766477..1766845 (-) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | M7SDJ3 |
| Locus tag | OOK64_RS08895 | Protein ID | WP_001520924.1 |
| Coordinates | 1766842..1767063 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OOK64_RS08870 (1762037) | 1762037..1763107 | - | 1071 | WP_000907838.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
| OOK64_RS08875 (1763109) | 1763109..1763954 | - | 846 | WP_000572196.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| OOK64_RS08880 (1763951) | 1763951..1764838 | - | 888 | WP_000099303.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| OOK64_RS08885 (1764902) | 1764902..1766218 | - | 1317 | WP_000624747.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| OOK64_RS08890 (1766477) | 1766477..1766845 | - | 369 | WP_001521773.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| OOK64_RS08895 (1766842) | 1766842..1767063 | - | 222 | WP_001520924.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| OOK64_RS08900 (1767195) | 1767195..1767908 | - | 714 | WP_000416114.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| OOK64_RS08905 (1767910) | 1767910..1768677 | - | 768 | WP_000082083.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| OOK64_RS08910 (1768674) | 1768674..1769951 | - | 1278 | WP_000803766.1 | branched chain amino acid ABC transporter permease LivM | - |
| OOK64_RS08915 (1769948) | 1769948..1770874 | - | 927 | WP_000003007.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| OOK64_RS08920 (1770934) | 1770934..1772043 | - | 1110 | WP_000822976.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 1761300..1769951 | 8651 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13587.92 Da Isoelectric Point: 7.3190
>T264089 WP_001521773.1 NZ_CP110657:c1766845-1766477 [Salmonella enterica subsp. enterica]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLKQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLKQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A607IPC3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6C6Z871 |