Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 1766477..1767063 Replicon chromosome
Accession NZ_CP110657
Organism Salmonella enterica subsp. enterica strain S2122

Toxin (Protein)


Gene name doc Uniprot ID E8XF70
Locus tag OOK64_RS08890 Protein ID WP_001521773.1
Coordinates 1766477..1766845 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID M7SDJ3
Locus tag OOK64_RS08895 Protein ID WP_001520924.1
Coordinates 1766842..1767063 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OOK64_RS08870 (1762037) 1762037..1763107 - 1071 WP_000907838.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
OOK64_RS08875 (1763109) 1763109..1763954 - 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
OOK64_RS08880 (1763951) 1763951..1764838 - 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
OOK64_RS08885 (1764902) 1764902..1766218 - 1317 WP_000624747.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
OOK64_RS08890 (1766477) 1766477..1766845 - 369 WP_001521773.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
OOK64_RS08895 (1766842) 1766842..1767063 - 222 WP_001520924.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OOK64_RS08900 (1767195) 1767195..1767908 - 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
OOK64_RS08905 (1767910) 1767910..1768677 - 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
OOK64_RS08910 (1768674) 1768674..1769951 - 1278 WP_000803766.1 branched chain amino acid ABC transporter permease LivM -
OOK64_RS08915 (1769948) 1769948..1770874 - 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
OOK64_RS08920 (1770934) 1770934..1772043 - 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 1761300..1769951 8651


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(24-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13587.92 Da        Isoelectric Point: 7.3190

>T264089 WP_001521773.1 NZ_CP110657:c1766845-1766477 [Salmonella enterica subsp. enterica]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLKQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8152.14 Da        Isoelectric Point: 5.0775

>AT264089 WP_001520924.1 NZ_CP110657:c1767063-1766842 [Salmonella enterica subsp. enterica]
MRTVNYSEARQNLAEVLESAVTGGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A607IPC3

Antitoxin

Source ID Structure
AlphaFold DB A0A6C6Z871

References