Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1086681..1087495 | Replicon | chromosome |
Accession | NZ_CP110657 | ||
Organism | Salmonella enterica subsp. enterica strain S2122 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | Q57KM2 |
Locus tag | OOK64_RS05585 | Protein ID | WP_000971655.1 |
Coordinates | 1086968..1087495 (+) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | E8XL32 |
Locus tag | OOK64_RS05580 | Protein ID | WP_000855692.1 |
Coordinates | 1086681..1086971 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OOK64_RS05550 (1082631) | 1082631..1083281 | - | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
OOK64_RS05555 (1083738) | 1083738..1084181 | + | 444 | WP_000715092.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
OOK64_RS05560 (1084612) | 1084612..1085061 | + | 450 | WP_000381610.1 | membrane protein | - |
OOK64_RS05565 (1085046) | 1085046..1085393 | + | 348 | WP_001669174.1 | DUF1493 family protein | - |
OOK64_RS05570 (1085666) | 1085666..1085992 | - | 327 | WP_000393302.1 | hypothetical protein | - |
OOK64_RS05575 (1086233) | 1086233..1086411 | + | 179 | Protein_1088 | IS3 family transposase | - |
OOK64_RS05580 (1086681) | 1086681..1086971 | + | 291 | WP_000855692.1 | DUF1778 domain-containing protein | Antitoxin |
OOK64_RS05585 (1086968) | 1086968..1087495 | + | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
OOK64_RS05590 (1087568) | 1087568..1087773 | - | 206 | Protein_1091 | IS5/IS1182 family transposase | - |
OOK64_RS05595 (1088120) | 1088120..1088776 | + | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
OOK64_RS05600 (1088948) | 1088948..1089469 | - | 522 | WP_000858988.1 | hypothetical protein | - |
OOK64_RS05605 (1089628) | 1089628..1092195 | + | 2568 | WP_001005807.1 | DNA mismatch repair protein MutS | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 1087568..1087744 | 176 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T264085 WP_000971655.1 NZ_CP110657:1086968-1087495 [Salmonella enterica subsp. enterica]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 6G96 | |
PDB | 7AK9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A625WHV3 |