Detailed information of TA system TA264085

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): tacAT/DUF1778(antitoxin)
• Location: 1086681..1087495
• Replicon: chromosome
• Accession: NZ_CP110657
• Organism: Salmonella enterica subsp. enterica strain S2122

Toxin (Protein)

• Gene name: TacT3
• Uniprot ID: Q57KM2
• Locus tag: OOK64_RS05585
• Protein ID: WP_000971655.1
• Coordinates: 1086968..1087495 (+)
• Length: 176 a.a.

Antitoxin (Protein)

• Gene name: TacA3
• Uniprot ID: E8XL32
• Locus tag: OOK64_RS05580
• Protein ID: WP_000855692.1
• Coordinates: 1086681..1086971 (+)
• Length: 97 a.a.

Genomic Context

Location: 1083738..1084181 (444 bp)
Type: Others
Protein ID: WP_000715092.1

Location: 1084612..1085061 (450 bp)
Type: Others
Protein ID: WP_000381610.1

Location: 1085046..1085393 (348 bp)
Type: Others
Protein ID: WP_001669174.1

Location: 1086233..1086411 (179 bp)
Type: Others
Protein ID: Protein_1088

Location: 1086681..1086971 (291 bp)
Type: Antitoxin
Protein ID: WP_000855692.1

Location: 1086968..1087495 (528 bp)
Type: Toxin
Protein ID: WP_000971655.1

Location: 1088120..1088776 (657 bp)
Type: Others
Protein ID: WP_000420452.1

Location: 1089628..1092195 (2568 bp)
Type: Others
Protein ID: WP_001005807.1

Location: 1082631..1083281 (651 bp)
Type: Others
Protein ID: WP_001674874.1

Location: 1085666..1085992 (327 bp)
Type: Others
Protein ID: WP_000393302.1

Location: 1087568..1087773 (206 bp)
Type: Others
Protein ID: Protein_1091

Location: 1088948..1089469 (522 bp)
Type: Others
Protein ID: WP_000858988.1

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
OOK64_RS05550 (1082631)	1082631..1083281	-	651	WP_001674874.1	type III secretion system transcriptional activator InvF	-
OOK64_RS05555 (1083738)	1083738..1084181	+	444	WP_000715092.1	SPI-1 type III secretion system invasion lipoprotein InvH	-
OOK64_RS05560 (1084612)	1084612..1085061	+	450	WP_000381610.1	membrane protein	-
OOK64_RS05565 (1085046)	1085046..1085393	+	348	WP_001669174.1	DUF1493 family protein	-
OOK64_RS05570 (1085666)	1085666..1085992	-	327	WP_000393302.1	hypothetical protein	-
OOK64_RS05575 (1086233)	1086233..1086411	+	179	Protein_1088	IS3 family transposase	-
OOK64_RS05580 (1086681)	1086681..1086971	+	291	WP_000855692.1	DUF1778 domain-containing protein	Antitoxin
OOK64_RS05585 (1086968)	1086968..1087495	+	528	WP_000971655.1	GNAT family N-acetyltransferase	Toxin
OOK64_RS05590 (1087568)	1087568..1087773	-	206	Protein_1091	IS5/IS1182 family transposase	-
OOK64_RS05595 (1088120)	1088120..1088776	+	657	WP_000420452.1	protein-serine/threonine phosphatase	-
OOK64_RS05600 (1088948)	1088948..1089469	-	522	WP_000858988.1	hypothetical protein	-
OOK64_RS05605 (1089628)	1089628..1092195	+	2568	WP_001005807.1	DNA mismatch repair protein MutS	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_016810 Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 IS/Tn TA025955 3070795..3070971 0 View NC_016856 Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S IS/Tn TA026055 3068456..3068632 0 View UFRD01000002 Salmonella enterica subsp. enterica serovar Typhimurium strain NCTC12023 IS/Tn TA010052 4599654..4599830 0	flank	IS/Tn	-	-	1087568..1087744	176

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

No domain identified.

Antitoxin

• Vibrio phage ICP1, Orf50 (1-95)

Sequences

Toxin

Protein

• Length: 176 a.a.
• Molecular weight: 19069.91 Da
• Isoelectric Point: 9.6420

>T264085 WP_000971655.1 NZ_CP110657:1086968-1087495 [Salmonella enterica subsp. enterica]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL

Nucleotide

• Length: 528 bp

Antitoxin

Protein

• Length: 97 a.a.
• Molecular weight: 10678.57 Da
• Isoelectric Point: 8.5779

>AT264085 WP_000855692.1 NZ_CP110657:1086681-1086971 [Salmonella enterica subsp. enterica]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTKMIMEILDNPPAP
NEKLLAAAFALPDMKK

Nucleotide

• Length: 291 bp

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• PDB: 6G96
• PDB: 7AK9

Antitoxin

Loading, please wait

• PDB: 7AK9
• AlphaFold DB: A0A625WHV3