Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 490099..490652 | Replicon | chromosome |
Accession | NZ_CP110362 | ||
Organism | Dickeya dadantii strain XJ12 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | E0SJL3 |
Locus tag | OL445_RS02295 | Protein ID | WP_013318624.1 |
Coordinates | 490099..490413 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | E0SJL4 |
Locus tag | OL445_RS02300 | Protein ID | WP_013318625.1 |
Coordinates | 490416..490652 (-) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OL445_RS02285 | 489539..489832 | + | 294 | Protein_447 | integrase | - |
OL445_RS02290 | 489830..490102 | + | 273 | Protein_448 | molybdopterin-guanine dinucleotide biosynthesis protein MobC | - |
OL445_RS02295 | 490099..490413 | - | 315 | WP_013318624.1 | CcdB family protein | Toxin |
OL445_RS02300 | 490416..490652 | - | 237 | WP_013318625.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
OL445_RS02305 | 490967..491911 | - | 945 | WP_033111950.1 | zincin-like metallopeptidase domain-containing protein | - |
OL445_RS02310 | 492626..493945 | + | 1320 | Protein_452 | TerB N-terminal domain-containing protein | - |
OL445_RS02315 | 493933..494358 | + | 426 | Protein_453 | DEAD/DEAH box helicase | - |
OL445_RS02320 | 494441..494569 | - | 129 | WP_284603348.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Integrative and Conjugative Element | - | vgrG2 / hcp | 427843..502453 | 74610 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11564.48 Da Isoelectric Point: 7.9859
>T263715 WP_013318624.1 NZ_CP110362:c490413-490099 [Dickeya dadantii]
MQFTVYGNTGKSAVYPLLLDVTSDIIGQLNRRIVIPLLPVEKYPAGRRPERFVPVVRLTDGKEYAVMTHELASIPVQALG
TVFCDASQYRNQIKAAIDFLIDGI
MQFTVYGNTGKSAVYPLLLDVTSDIIGQLNRRIVIPLLPVEKYPAGRRPERFVPVVRLTDGKEYAVMTHELASIPVQALG
TVFCDASQYRNQIKAAIDFLIDGI
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|