Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 466898..467451 Replicon chromosome
Accession NZ_CP110362
Organism Dickeya dadantii strain XJ12

Toxin (Protein)


Gene name ccdB Uniprot ID E0SJK1
Locus tag OL445_RS02235 Protein ID WP_013318612.1
Coordinates 466898..467212 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID E0SJK2
Locus tag OL445_RS02240 Protein ID WP_013318613.1
Coordinates 467215..467451 (-) Length 79 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OL445_RS02200 461921..463159 + 1239 WP_033111949.1 IS110 family transposase -
OL445_RS02205 463280..464146 - 867 WP_202796554.1 hypothetical protein -
OL445_RS02210 464372..465028 - 657 WP_013318607.1 hypothetical protein -
OL445_RS02215 465332..465775 - 444 WP_013318608.1 hypothetical protein -
OL445_RS02220 465984..466277 - 294 WP_013318609.1 hypothetical protein -
OL445_RS02225 466244..466531 - 288 WP_013318610.1 hypothetical protein -
OL445_RS02230 466767..466901 + 135 Protein_436 mobilization protein mobC -
OL445_RS02235 466898..467212 - 315 WP_013318612.1 CcdB family protein Toxin
OL445_RS02240 467215..467451 - 237 WP_013318613.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
OL445_RS02245 467722..468007 + 286 Protein_439 integrase core domain-containing protein -
OL445_RS02250 468870..469280 + 411 WP_148226884.1 hypothetical protein -
OL445_RS02255 469343..469738 + 396 WP_013318616.1 hypothetical protein -
OL445_RS02260 469752..471068 + 1317 WP_013318617.1 hypothetical protein -
OL445_RS02265 471081..471953 + 873 WP_071819884.1 deoxyribonuclease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Integrative and Conjugative Element - vgrG2 / hcp 427843..502453 74610


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(9-78)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11412.32 Da        Isoelectric Point: 7.9859

>T263714 WP_013318612.1 NZ_CP110362:c467212-466898 [Dickeya dadantii]
MQFTVYGNTGKSAIYPLLLDVTSDIIGQLNRRIVIPLLPVEKYPAGRRPDRPVPVVRLTDGKEYAVMTHELASIPVQALG
AVFCDASPYRSQVKAAIDFLIDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 79 a.a.        Molecular weight: 8973.99 Da        Isoelectric Point: 6.0711

>AT263714 WP_013318613.1 NZ_CP110362:c467451-467215 [Dickeya dadantii]
MTAKQRNTQSVTMTVERALLVRAREAGINLSATLTAALDAELRHHEAKKWQEENRESIDALNRFHDEHGCFSDEYLTF

Download         Length: 237 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB E0SJK1

Antitoxin

Source ID Structure
AlphaFold DB E0SJK2

References