Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
| Location | 4634420..4635234 | Replicon | chromosome |
| Accession | NZ_CP110018 | ||
| Organism | Escherichia coli strain DH10B | ||
Toxin (Protein)
| Gene name | yjhX | Uniprot ID | S1PA82 |
| Locus tag | OLR78_RS22690 | Protein ID | WP_001054376.1 |
| Coordinates | 4634977..4635234 (-) | Length | 86 a.a. |
Antitoxin (Protein)
| Gene name | yjhQ | Uniprot ID | U9Z4B8 |
| Locus tag | OLR78_RS22685 | Protein ID | WP_001309181.1 |
| Coordinates | 4634420..4634965 (-) | Length | 182 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLR78_RS22655 (4630111) | 4630111..4631424 | - | 1314 | WP_000460843.1 | PTS sugar transporter subunit IIC SgcC | - |
| OLR78_RS22660 (4631436) | 4631436..4631714 | - | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB SgcB | - |
| OLR78_RS22665 (4631711) | 4631711..4632832 | - | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
| OLR78_RS22670 (4633077) | 4633077..4633193 | - | 117 | Protein_4414 | VOC family protein | - |
| OLR78_RS22675 (4633231) | 4633231..4633449 | - | 219 | Protein_4415 | hypothetical protein | - |
| OLR78_RS22680 (4633618) | 4633618..4634364 | - | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
| OLR78_RS22685 (4634420) | 4634420..4634965 | - | 546 | WP_001309181.1 | N-acetyltransferase | Antitoxin |
| OLR78_RS22690 (4634977) | 4634977..4635234 | - | 258 | WP_001054376.1 | YjhX family toxin | Toxin |
| OLR78_RS22695 (4635725) | 4635725..4635856 | - | 132 | WP_001309182.1 | hypothetical protein | - |
| OLR78_RS22700 (4635972) | 4635972..4637212 | + | 1241 | Protein_4420 | helicase YjhR | - |
| OLR78_RS22705 (4637480) | 4637480..4637685 | - | 206 | Protein_4421 | HNH endonuclease | - |
| OLR78_RS22710 (4637795) | 4637795..4638775 | - | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
| OLR78_RS22715 (4638840) | 4638840..4639946 | - | 1107 | WP_001309184.1 | N-acetylneuraminate epimerase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | - | 4634420..4650672 | 16252 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T262761 WP_001054376.1 NZ_CP110018:c4635234-4634977 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19956.90 Da Isoelectric Point: 6.3277
>AT262761 WP_001309181.1 NZ_CP110018:c4634965-4634420 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|