Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 4635178..4635992 | Replicon | chromosome |
Accession | NZ_CP110016 | ||
Organism | Escherichia coli strain HE_100 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | S1PA82 |
Locus tag | OLR74_RS22710 | Protein ID | WP_001054376.1 |
Coordinates | 4635735..4635992 (-) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | U9Z4B8 |
Locus tag | OLR74_RS22705 | Protein ID | WP_001309181.1 |
Coordinates | 4635178..4635723 (-) | Length | 182 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLR74_RS22675 (4630869) | 4630869..4632182 | - | 1314 | WP_000460843.1 | PTS sugar transporter subunit IIC SgcC | - |
OLR74_RS22680 (4632194) | 4632194..4632472 | - | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB SgcB | - |
OLR74_RS22685 (4632469) | 4632469..4633590 | - | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
OLR74_RS22690 (4633835) | 4633835..4633951 | - | 117 | Protein_4418 | VOC family protein | - |
OLR74_RS22695 (4633989) | 4633989..4634207 | - | 219 | Protein_4419 | hypothetical protein | - |
OLR74_RS22700 (4634376) | 4634376..4635122 | - | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
OLR74_RS22705 (4635178) | 4635178..4635723 | - | 546 | WP_001309181.1 | N-acetyltransferase | Antitoxin |
OLR74_RS22710 (4635735) | 4635735..4635992 | - | 258 | WP_001054376.1 | YjhX family toxin | Toxin |
OLR74_RS22715 (4636483) | 4636483..4636614 | - | 132 | WP_001309182.1 | hypothetical protein | - |
OLR74_RS22720 (4636730) | 4636730..4637970 | + | 1241 | Protein_4424 | helicase YjhR | - |
OLR74_RS22725 (4638238) | 4638238..4638443 | - | 206 | Protein_4425 | HNH endonuclease | - |
OLR74_RS22730 (4638553) | 4638553..4639533 | - | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
OLR74_RS22735 (4639598) | 4639598..4640703 | - | 1106 | Protein_4427 | N-acetylneuraminate epimerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 4635178..4651429 | 16251 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T262709 WP_001054376.1 NZ_CP110016:c4635992-4635735 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19956.90 Da Isoelectric Point: 6.3277
>AT262709 WP_001309181.1 NZ_CP110016:c4635723-4635178 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|