Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 4635183..4635997 | Replicon | chromosome |
Accession | NZ_CP110015 | ||
Organism | Escherichia coli strain HE_150 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | S1PA82 |
Locus tag | OLR73_RS22700 | Protein ID | WP_001054376.1 |
Coordinates | 4635740..4635997 (-) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | U9Z4B8 |
Locus tag | OLR73_RS22695 | Protein ID | WP_001309181.1 |
Coordinates | 4635183..4635728 (-) | Length | 182 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLR73_RS22665 (4630874) | 4630874..4632187 | - | 1314 | WP_283012230.1 | PTS sugar transporter subunit IIC SgcC | - |
OLR73_RS22670 (4632199) | 4632199..4632477 | - | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB SgcB | - |
OLR73_RS22675 (4632474) | 4632474..4633595 | - | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
OLR73_RS22680 (4633840) | 4633840..4633956 | - | 117 | Protein_4416 | VOC family protein | - |
OLR73_RS22685 (4633994) | 4633994..4634212 | - | 219 | Protein_4417 | hypothetical protein | - |
OLR73_RS22690 (4634381) | 4634381..4635127 | - | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
OLR73_RS22695 (4635183) | 4635183..4635728 | - | 546 | WP_001309181.1 | N-acetyltransferase | Antitoxin |
OLR73_RS22700 (4635740) | 4635740..4635997 | - | 258 | WP_001054376.1 | YjhX family toxin | Toxin |
OLR73_RS22705 (4636488) | 4636488..4636619 | - | 132 | WP_001309182.1 | hypothetical protein | - |
OLR73_RS22710 (4636735) | 4636735..4637975 | + | 1241 | Protein_4422 | helicase YjhR | - |
OLR73_RS22715 (4638243) | 4638243..4638448 | - | 206 | Protein_4423 | HNH endonuclease | - |
OLR73_RS22720 (4638558) | 4638558..4639538 | - | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
OLR73_RS22725 (4639603) | 4639603..4640708 | - | 1106 | Protein_4425 | N-acetylneuraminate epimerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 4635183..4651434 | 16251 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T262683 WP_001054376.1 NZ_CP110015:c4635997-4635740 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19956.90 Da Isoelectric Point: 6.3277
>AT262683 WP_001309181.1 NZ_CP110015:c4635728-4635183 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|