Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 4635171..4635985 | Replicon | chromosome |
Accession | NZ_CP110014 | ||
Organism | Escherichia coli strain HE_100-10 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | S1PA82 |
Locus tag | OLR77_RS22705 | Protein ID | WP_001054376.1 |
Coordinates | 4635728..4635985 (-) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | U9Z4B8 |
Locus tag | OLR77_RS22700 | Protein ID | WP_001309181.1 |
Coordinates | 4635171..4635716 (-) | Length | 182 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLR77_RS22670 (4630862) | 4630862..4632175 | - | 1314 | WP_000460843.1 | PTS sugar transporter subunit IIC SgcC | - |
OLR77_RS22675 (4632187) | 4632187..4632465 | - | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB SgcB | - |
OLR77_RS22680 (4632462) | 4632462..4633583 | - | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
OLR77_RS22685 (4633828) | 4633828..4633944 | - | 117 | Protein_4417 | VOC family protein | - |
OLR77_RS22690 (4633982) | 4633982..4634200 | - | 219 | Protein_4418 | hypothetical protein | - |
OLR77_RS22695 (4634369) | 4634369..4635115 | - | 747 | WP_282992804.1 | class I SAM-dependent methyltransferase | - |
OLR77_RS22700 (4635171) | 4635171..4635716 | - | 546 | WP_001309181.1 | N-acetyltransferase | Antitoxin |
OLR77_RS22705 (4635728) | 4635728..4635985 | - | 258 | WP_001054376.1 | YjhX family toxin | Toxin |
OLR77_RS22710 (4636476) | 4636476..4636607 | - | 132 | WP_001309182.1 | hypothetical protein | - |
OLR77_RS22715 (4636723) | 4636723..4637963 | + | 1241 | Protein_4423 | helicase YjhR | - |
OLR77_RS22720 (4638231) | 4638231..4638436 | - | 206 | Protein_4424 | HNH endonuclease | - |
OLR77_RS22725 (4638546) | 4638546..4639526 | - | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
OLR77_RS22730 (4639591) | 4639591..4640696 | - | 1106 | Protein_4426 | N-acetylneuraminate epimerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 4635171..4651422 | 16251 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T262657 WP_001054376.1 NZ_CP110014:c4635985-4635728 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19956.90 Da Isoelectric Point: 6.3277
>AT262657 WP_001309181.1 NZ_CP110014:c4635716-4635171 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|