260399

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 313360..313946 Replicon chromosome
Accession NZ_CP107010
Organism Salmonella enterica subsp. enterica serovar Paratyphi B strain SZ21B23

Toxin (Protein)


Gene name doc Uniprot ID A0A5I5SZA2
Locus tag OF884_RS01430 Protein ID WP_001536192.1
Coordinates 313578..313946 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID M7SDJ3
Locus tag OF884_RS01425 Protein ID WP_001520924.1
Coordinates 313360..313581 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OF884_RS01400 (308379) 308379..309488 + 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
OF884_RS01405 (309548) 309548..310474 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
OF884_RS01410 (310471) 310471..311748 + 1278 WP_000803764.1 branched chain amino acid ABC transporter permease LivM -
OF884_RS01415 (311745) 311745..312512 + 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
OF884_RS01420 (312514) 312514..313227 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
OF884_RS01425 (313360) 313360..313581 + 222 WP_001520924.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OF884_RS01430 (313578) 313578..313946 + 369 WP_001536192.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
OF884_RS01435 (314205) 314205..315521 + 1317 WP_000624747.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
OF884_RS01440 (315626) 315626..316513 + 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
OF884_RS01445 (316510) 316510..317355 + 846 WP_023210218.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
OF884_RS01450 (317357) 317357..318427 + 1071 WP_023210217.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 310471..319164 8693


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-122)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13645.92 Da        Isoelectric Point: 6.2230

>T260399 WP_001536192.1 NZ_CP107010:313578-313946 [Salmonella enterica subsp. enterica serovar Paratyphi B]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPERAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8152.14 Da        Isoelectric Point: 5.0775

>AT260399 WP_001520924.1 NZ_CP107010:313360-313581 [Salmonella enterica subsp. enterica serovar Paratyphi B]
MRTVNYSEARQNLAEVLESAVTGGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5I5SZA2

Antitoxin

Source ID Structure
AlphaFold DB A0A6C6Z871

References