Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 1111411..1112078 | Replicon | chromosome |
Accession | NZ_CP107002 | ||
Organism | Escherichia coli strain SY22C3 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | Q46953 |
Locus tag | OFB02_RS05395 | Protein ID | WP_001094400.1 |
Coordinates | 1111411..1111740 (-) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | P52141 |
Locus tag | OFB02_RS05400 | Protein ID | WP_000072690.1 |
Coordinates | 1111761..1112078 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OFB02_RS05390 (1106467) | 1106467..1111047 | + | 4581 | WP_010723187.1 | adhesin-like autotransporter YpjA/EhaD | - |
OFB02_RS05395 (1111411) | 1111411..1111740 | - | 330 | WP_001094400.1 | type IV toxin-antitoxin system toxin YpjF | Toxin |
OFB02_RS05400 (1111761) | 1111761..1112078 | - | 318 | WP_000072690.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
OFB02_RS05405 (1112116) | 1112116..1112316 | - | 201 | WP_001395452.1 | DUF987 domain-containing protein | - |
OFB02_RS05410 (1112325) | 1112325..1112807 | - | 483 | WP_001407480.1 | RadC family protein | - |
OFB02_RS05415 (1112816) | 1112816..1113274 | - | 459 | WP_000211841.1 | antirestriction protein | - |
OFB02_RS05420 (1113377) | 1113377..1113561 | - | 185 | Protein_1058 | DUF905 family protein | - |
OFB02_RS05425 (1114172) | 1114172..1115875 | - | 1704 | WP_000896263.1 | protein YfjW | - |
OFB02_RS05430 (1116017) | 1116017..1117026 | + | 1010 | Protein_1060 | arsenic transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 1101759..1133639 | 31880 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12308.21 Da Isoelectric Point: 7.2761
>T260305 WP_001094400.1 NZ_CP107002:c1111740-1111411 [Escherichia coli]
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A373F4I3 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 2EA9 | |
PDB | 2JN7 | |
AlphaFold DB | P52141 |