Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 988625..989439 | Replicon | chromosome |
Accession | NZ_CP104641 | ||
Organism | Salmonella enterica strain 1019942 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | Q57KM2 |
Locus tag | N5927_RS04715 | Protein ID | WP_000971655.1 |
Coordinates | 988625..989152 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | M7S6I2 |
Locus tag | N5927_RS04720 | Protein ID | WP_000855694.1 |
Coordinates | 989149..989439 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5927_RS04690 (984914) | 984914..985312 | + | 399 | Protein_918 | cytoplasmic protein | - |
N5927_RS04695 (985898) | 985898..986566 | + | 669 | WP_000445914.1 | hypothetical protein | - |
N5927_RS04700 (986593) | 986593..987087 | + | 495 | WP_000424949.1 | hypothetical protein | - |
N5927_RS04705 (987332) | 987332..987988 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
N5927_RS04710 (988347) | 988347..988552 | + | 206 | Protein_922 | IS5/IS1182 family transposase | - |
N5927_RS04715 (988625) | 988625..989152 | - | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
N5927_RS04720 (989149) | 989149..989439 | - | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
N5927_RS04725 (989709) | 989709..989898 | - | 190 | Protein_925 | IS3 family transposase | - |
N5927_RS04730 (990302) | 990302..990745 | - | 444 | WP_000715096.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
N5927_RS04735 (991201) | 991201..991851 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
N5927_RS04740 (991848) | 991848..993536 | + | 1689 | WP_000848113.1 | type III secretion system outer membrane ring protein InvG | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 988376..988552 | 176 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T258743 WP_000971655.1 NZ_CP104641:c989152-988625 [Salmonella enterica]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 6G96 | |
PDB | 7AK9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V8SJE7 |