Detailed information of TA system TA258743

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): tacAT/DUF1778(antitoxin)
• Location: 988625..989439
• Replicon: chromosome
• Accession: NZ_CP104641
• Organism: Salmonella enterica strain 1019942

Toxin (Protein)

• Gene name: TacT3
• Uniprot ID: Q57KM2
• Locus tag: N5927_RS04715
• Protein ID: WP_000971655.1
• Coordinates: 988625..989152 (-)
• Length: 176 a.a.

Antitoxin (Protein)

• Gene name: TacA3
• Uniprot ID: M7S6I2
• Locus tag: N5927_RS04720
• Protein ID: WP_000855694.1
• Coordinates: 989149..989439 (-)
• Length: 97 a.a.

Genomic Context

Location: 984914..985312 (399 bp)
Type: Others
Protein ID: Protein_918

Location: 985898..986566 (669 bp)
Type: Others
Protein ID: WP_000445914.1

Location: 986593..987087 (495 bp)
Type: Others
Protein ID: WP_000424949.1

Location: 988347..988552 (206 bp)
Type: Others
Protein ID: Protein_922

Location: 991201..991851 (651 bp)
Type: Others
Protein ID: WP_001674874.1

Location: 991848..993536 (1689 bp)
Type: Others
Protein ID: WP_000848113.1

Location: 987332..987988 (657 bp)
Type: Others
Protein ID: WP_000420452.1

Location: 988625..989152 (528 bp)
Type: Toxin
Protein ID: WP_000971655.1

Location: 989149..989439 (291 bp)
Type: Antitoxin
Protein ID: WP_000855694.1

Location: 989709..989898 (190 bp)
Type: Others
Protein ID: Protein_925

Location: 990302..990745 (444 bp)
Type: Others
Protein ID: WP_000715096.1

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
N5927_RS04690 (984914)	984914..985312	+	399	Protein_918	cytoplasmic protein	-
N5927_RS04695 (985898)	985898..986566	+	669	WP_000445914.1	hypothetical protein	-
N5927_RS04700 (986593)	986593..987087	+	495	WP_000424949.1	hypothetical protein	-
N5927_RS04705 (987332)	987332..987988	-	657	WP_000420452.1	protein-serine/threonine phosphatase	-
N5927_RS04710 (988347)	988347..988552	+	206	Protein_922	IS5/IS1182 family transposase	-
N5927_RS04715 (988625)	988625..989152	-	528	WP_000971655.1	GNAT family N-acetyltransferase	Toxin
N5927_RS04720 (989149)	989149..989439	-	291	WP_000855694.1	DUF1778 domain-containing protein	Antitoxin
N5927_RS04725 (989709)	989709..989898	-	190	Protein_925	IS3 family transposase	-
N5927_RS04730 (990302)	990302..990745	-	444	WP_000715096.1	SPI-1 type III secretion system invasion lipoprotein InvH	-
N5927_RS04735 (991201)	991201..991851	+	651	WP_001674874.1	type III secretion system transcriptional activator InvF	-
N5927_RS04740 (991848)	991848..993536	+	1689	WP_000848113.1	type III secretion system outer membrane ring protein InvG	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_016810 Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 IS/Tn TA025955 3070795..3070971 0.007 View NC_016856 Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S IS/Tn TA026055 3068456..3068632 0.007 View UFRD01000002 Salmonella enterica subsp. enterica serovar Typhimurium strain NCTC12023 IS/Tn TA010052 4599654..4599830 0.007	flank	IS/Tn	-	-	988376..988552	176

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

No domain identified.

Antitoxin

• Vibrio phage ICP1, Orf50 (1-95)

Sequences

Toxin

Protein

• Length: 176 a.a.
• Molecular weight: 19069.91 Da
• Isoelectric Point: 9.6420

>T258743 WP_000971655.1 NZ_CP104641:c989152-988625 [Salmonella enterica]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL

Nucleotide

• Length: 528 bp

Antitoxin

Protein

• Length: 97 a.a.
• Molecular weight: 10664.50 Da
• Isoelectric Point: 6.3133

>AT258743 WP_000855694.1 NZ_CP104641:c989439-989149 [Salmonella enterica]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK

Nucleotide

• Length: 291 bp

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• PDB: 6G96
• PDB: 7AK9

Antitoxin

Loading, please wait

• AlphaFold DB: A0A3V8SJE7