Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 3958949..3959535 | Replicon | chromosome |
| Accession | NZ_CP104638 | ||
| Organism | Salmonella enterica strain PNUSAS118466 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | A0A0R9MYB2 |
| Locus tag | N4311_RS20310 | Protein ID | WP_000174966.1 |
| Coordinates | 3959167..3959535 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | A0A0R9PI96 |
| Locus tag | N4311_RS20305 | Protein ID | WP_001535398.1 |
| Coordinates | 3958949..3959170 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4311_RS20280 (3953969) | 3953969..3955078 | + | 1110 | WP_000822976.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| N4311_RS20285 (3955138) | 3955138..3956064 | + | 927 | WP_000003007.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| N4311_RS20290 (3956061) | 3956061..3957338 | + | 1278 | WP_000803766.1 | branched chain amino acid ABC transporter permease LivM | - |
| N4311_RS20295 (3957335) | 3957335..3958102 | + | 768 | WP_000082083.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| N4311_RS20300 (3958104) | 3958104..3958817 | + | 714 | WP_000416114.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| N4311_RS20305 (3958949) | 3958949..3959170 | + | 222 | WP_001535398.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| N4311_RS20310 (3959167) | 3959167..3959535 | + | 369 | WP_000174966.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| N4311_RS20315 (3959794) | 3959794..3961110 | + | 1317 | WP_000624747.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| N4311_RS20320 (3961215) | 3961215..3962102 | + | 888 | WP_000099303.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| N4311_RS20325 (3962099) | 3962099..3962944 | + | 846 | WP_000572196.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| N4311_RS20330 (3962947) | 3962947..3964017 | + | 1071 | WP_000907845.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 3956061..3964754 | 8693 | ||
| - | inside | Prophage | - | - | 3953969..3964754 | 10785 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13629.91 Da Isoelectric Point: 6.4657
>T258706 WP_000174966.1 NZ_CP104638:3959167-3959535 [Salmonella enterica]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLTISRGYIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLTISRGYIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0R9MYB2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0R9PI96 |