258706

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 3958949..3959535 Replicon chromosome
Accession NZ_CP104638
Organism Salmonella enterica strain PNUSAS118466

Toxin (Protein)


Gene name doc Uniprot ID A0A0R9MYB2
Locus tag N4311_RS20310 Protein ID WP_000174966.1
Coordinates 3959167..3959535 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0R9PI96
Locus tag N4311_RS20305 Protein ID WP_001535398.1
Coordinates 3958949..3959170 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N4311_RS20280 (3953969) 3953969..3955078 + 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
N4311_RS20285 (3955138) 3955138..3956064 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
N4311_RS20290 (3956061) 3956061..3957338 + 1278 WP_000803766.1 branched chain amino acid ABC transporter permease LivM -
N4311_RS20295 (3957335) 3957335..3958102 + 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
N4311_RS20300 (3958104) 3958104..3958817 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
N4311_RS20305 (3958949) 3958949..3959170 + 222 WP_001535398.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
N4311_RS20310 (3959167) 3959167..3959535 + 369 WP_000174966.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
N4311_RS20315 (3959794) 3959794..3961110 + 1317 WP_000624747.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
N4311_RS20320 (3961215) 3961215..3962102 + 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
N4311_RS20325 (3962099) 3962099..3962944 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
N4311_RS20330 (3962947) 3962947..3964017 + 1071 WP_000907845.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 3956061..3964754 8693
- inside Prophage - - 3953969..3964754 10785


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-122)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13629.91 Da        Isoelectric Point: 6.4657

>T258706 WP_000174966.1 NZ_CP104638:3959167-3959535 [Salmonella enterica]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLTISRGYIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8165.23 Da        Isoelectric Point: 6.4643

>AT258706 WP_001535398.1 NZ_CP104638:3958949-3959170 [Salmonella enterica]
MRTVNYSEARQNLAEVLESAVTAGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRKLADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0R9MYB2

Antitoxin

Source ID Structure
AlphaFold DB A0A0R9PI96

References