Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 321902..322488 Replicon chromosome
Accession NZ_CP104482
Organism Salmonella enterica strain SalSpp_sample_08_No.4

Toxin (Protein)


Gene name doc Uniprot ID A0A0R9MYB2
Locus tag N4230_RS01465 Protein ID WP_000174966.1
Coordinates 322120..322488 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0R9PI96
Locus tag N4230_RS01460 Protein ID WP_001535398.1
Coordinates 321902..322123 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N4230_RS01435 (316922) 316922..318031 + 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
N4230_RS01440 (318091) 318091..319017 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
N4230_RS01445 (319014) 319014..320291 + 1278 WP_000803766.1 branched chain amino acid ABC transporter permease LivM -
N4230_RS01450 (320288) 320288..321055 + 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
N4230_RS01455 (321057) 321057..321770 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
N4230_RS01460 (321902) 321902..322123 + 222 WP_001535398.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
N4230_RS01465 (322120) 322120..322488 + 369 WP_000174966.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
N4230_RS01470 (322748) 322748..324064 + 1317 WP_000624747.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
N4230_RS01475 (324169) 324169..325056 + 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
N4230_RS01480 (325053) 325053..325898 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
N4230_RS01485 (325901) 325901..326971 + 1071 WP_000907838.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 319014..327708 8694


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-122)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13629.91 Da        Isoelectric Point: 6.4657

>T258057 WP_000174966.1 NZ_CP104482:322120-322488 [Salmonella enterica]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLTISRGYIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8165.23 Da        Isoelectric Point: 6.4643

>AT258057 WP_001535398.1 NZ_CP104482:321902-322123 [Salmonella enterica]
MRTVNYSEARQNLAEVLESAVTAGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRKLADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0R9MYB2

Antitoxin

Source ID Structure
AlphaFold DB A0A0R9PI96

References