Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 1034449..1035263 | Replicon | chromosome |
| Accession | NZ_CP104479 | ||
| Organism | Salmonella enterica strain SalSpp_sample_09_No.5 | ||
Toxin (Protein)
| Gene name | TacT3 | Uniprot ID | Q57KM2 |
| Locus tag | N4G50_RS04955 | Protein ID | WP_000971655.1 |
| Coordinates | 1034449..1034976 (-) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | TacA3 | Uniprot ID | M7S6I2 |
| Locus tag | N4G50_RS04960 | Protein ID | WP_000855694.1 |
| Coordinates | 1034973..1035263 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4G50_RS04925 (1030737) | 1030737..1031158 | + | 422 | Protein_966 | cytoplasmic protein | - |
| N4G50_RS04930 (1031326) | 1031326..1031565 | + | 240 | Protein_967 | hypothetical protein | - |
| N4G50_RS04935 (1031722) | 1031722..1032390 | + | 669 | WP_024156635.1 | hypothetical protein | - |
| N4G50_RS04940 (1032417) | 1032417..1032911 | + | 495 | WP_000424942.1 | hypothetical protein | - |
| N4G50_RS04945 (1033156) | 1033156..1033812 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
| N4G50_RS04950 (1034171) | 1034171..1034376 | + | 206 | Protein_971 | IS5/IS1182 family transposase | - |
| N4G50_RS04955 (1034449) | 1034449..1034976 | - | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
| N4G50_RS04960 (1034973) | 1034973..1035263 | - | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
| N4G50_RS04965 (1035533) | 1035533..1035733 | - | 201 | Protein_974 | IS3 family transposase | - |
| N4G50_RS04970 (1035974) | 1035974..1036300 | + | 327 | WP_000393302.1 | hypothetical protein | - |
| N4G50_RS04975 (1036573) | 1036573..1036920 | - | 348 | WP_001555786.1 | DUF1493 family protein | - |
| N4G50_RS04980 (1036905) | 1036905..1037354 | - | 450 | WP_024156634.1 | hypothetical protein | - |
| N4G50_RS04985 (1037786) | 1037786..1038229 | - | 444 | WP_000715100.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
| N4G50_RS04990 (1038685) | 1038685..1039335 | + | 651 | WP_001728903.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| flank | IS/Tn | - | - | 1034200..1034376 | 176 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T258043 WP_000971655.1 NZ_CP104479:c1034976-1034449 [Salmonella enterica]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6G96 | |
| PDB | 7AK9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3V8SJE7 |