Detailed information of TA system
Overview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 1108289..1108956 | Replicon | chromosome |
Accession | NZ_CP104328 | ||
Organism | Escherichia coli strain THB42-F2 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | Q46953 |
Locus tag | N0499_RS05320 | Protein ID | WP_001094400.1 |
Coordinates | 1108289..1108618 (-) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | P52141 |
Locus tag | N0499_RS05325 | Protein ID | WP_000072690.1 |
Coordinates | 1108639..1108956 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0499_RS05315 (1103345) | 1103345..1107925 | + | 4581 | WP_010723187.1 | adhesin-like autotransporter YpjA/EhaD | - |
N0499_RS05320 (1108289) | 1108289..1108618 | - | 330 | WP_001094400.1 | type IV toxin-antitoxin system toxin YpjF | Toxin |
N0499_RS05325 (1108639) | 1108639..1108956 | - | 318 | WP_000072690.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
N0499_RS05330 (1108994) | 1108994..1109194 | - | 201 | WP_001395452.1 | DUF987 domain-containing protein | - |
N0499_RS05335 (1109203) | 1109203..1109685 | - | 483 | WP_001407480.1 | RadC family protein | - |
N0499_RS05340 (1109694) | 1109694..1110152 | - | 459 | WP_000211841.1 | antirestriction protein | - |
N0499_RS05345 (1110255) | 1110255..1110478 | - | 224 | Protein_1042 | DUF905 domain-containing protein | - |
N0499_RS05350 (1111050) | 1111050..1112753 | - | 1704 | WP_000896263.1 | protein YfjW | - |
N0499_RS05355 (1112895) | 1112895..1113904 | + | 1010 | Protein_1044 | arsenic transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 1098637..1130517 | 31880 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12308.21 Da Isoelectric Point: 7.2761
>T257622 WP_001094400.1 NZ_CP104328:c1108618-1108289 [Escherichia coli]
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A373F4I3 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 2EA9 | |
PDB | 2JN7 | |
AlphaFold DB | P52141 |