Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 1107308..1107975 | Replicon | chromosome |
Accession | NZ_CP104326 | ||
Organism | Escherichia coli strain THB42-F1 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | Q46953 |
Locus tag | N0470_RS05315 | Protein ID | WP_001094400.1 |
Coordinates | 1107308..1107637 (-) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | P52141 |
Locus tag | N0470_RS05320 | Protein ID | WP_000072690.1 |
Coordinates | 1107658..1107975 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0470_RS05310 (1102364) | 1102364..1106944 | + | 4581 | WP_010723187.1 | adhesin-like autotransporter YpjA/EhaD | - |
N0470_RS05315 (1107308) | 1107308..1107637 | - | 330 | WP_001094400.1 | type IV toxin-antitoxin system toxin YpjF | Toxin |
N0470_RS05320 (1107658) | 1107658..1107975 | - | 318 | WP_000072690.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
N0470_RS05325 (1108013) | 1108013..1108213 | - | 201 | WP_001395452.1 | DUF987 domain-containing protein | - |
N0470_RS05330 (1108222) | 1108222..1108704 | - | 483 | WP_001407480.1 | RadC family protein | - |
N0470_RS05335 (1108713) | 1108713..1109171 | - | 459 | WP_000211841.1 | antirestriction protein | - |
N0470_RS05340 (1109274) | 1109274..1109497 | - | 224 | Protein_1041 | DUF905 domain-containing protein | - |
N0470_RS05345 (1110069) | 1110069..1111772 | - | 1704 | WP_000896263.1 | protein YfjW | - |
N0470_RS05350 (1111914) | 1111914..1112923 | + | 1010 | Protein_1043 | arsenic transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 1097656..1129536 | 31880 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12308.21 Da Isoelectric Point: 7.2761
>T257591 WP_001094400.1 NZ_CP104326:c1107637-1107308 [Escherichia coli]
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A373F4I3 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 2EA9 | |
PDB | 2JN7 | |
AlphaFold DB | P52141 |