Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 3401565..3402151 | Replicon | chromosome |
Accession | NZ_CP101907 | ||
Organism | Salmonella enterica subsp. enterica strain QA-1986 973 |
Toxin (Protein)
Gene name | doc | Uniprot ID | E8XF70 |
Locus tag | NP441_RS16650 | Protein ID | WP_001521773.1 |
Coordinates | 3401783..3402151 (+) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | M7SDJ3 |
Locus tag | NP441_RS16645 | Protein ID | WP_001520924.1 |
Coordinates | 3401565..3401786 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP441_RS16620 (3396585) | 3396585..3397694 | + | 1110 | WP_023250616.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
NP441_RS16625 (3397754) | 3397754..3398680 | + | 927 | WP_000003007.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
NP441_RS16630 (3398677) | 3398677..3399954 | + | 1278 | WP_000803766.1 | branched chain amino acid ABC transporter permease LivM | - |
NP441_RS16635 (3399951) | 3399951..3400718 | + | 768 | WP_000082083.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
NP441_RS16640 (3400720) | 3400720..3401433 | + | 714 | WP_000416114.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
NP441_RS16645 (3401565) | 3401565..3401786 | + | 222 | WP_001520924.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NP441_RS16650 (3401783) | 3401783..3402151 | + | 369 | WP_001521773.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
NP441_RS16655 (3402410) | 3402410..3403726 | + | 1317 | WP_000624747.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
NP441_RS16660 (3403790) | 3403790..3404677 | + | 888 | WP_000099303.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
NP441_RS16665 (3404674) | 3404674..3405519 | + | 846 | WP_000572196.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
NP441_RS16670 (3405521) | 3405521..3406591 | + | 1071 | WP_000907838.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 3398677..3407328 | 8651 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13587.92 Da Isoelectric Point: 7.3190
>T252873 WP_001521773.1 NZ_CP101907:3401783-3402151 [Salmonella enterica subsp. enterica]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLKQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLKQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A607IPC3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6C6Z871 |