252873

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 3401565..3402151 Replicon chromosome
Accession NZ_CP101907
Organism Salmonella enterica subsp. enterica strain QA-1986 973

Toxin (Protein)


Gene name doc Uniprot ID E8XF70
Locus tag NP441_RS16650 Protein ID WP_001521773.1
Coordinates 3401783..3402151 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID M7SDJ3
Locus tag NP441_RS16645 Protein ID WP_001520924.1
Coordinates 3401565..3401786 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NP441_RS16620 (3396585) 3396585..3397694 + 1110 WP_023250616.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
NP441_RS16625 (3397754) 3397754..3398680 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NP441_RS16630 (3398677) 3398677..3399954 + 1278 WP_000803766.1 branched chain amino acid ABC transporter permease LivM -
NP441_RS16635 (3399951) 3399951..3400718 + 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NP441_RS16640 (3400720) 3400720..3401433 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NP441_RS16645 (3401565) 3401565..3401786 + 222 WP_001520924.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NP441_RS16650 (3401783) 3401783..3402151 + 369 WP_001521773.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NP441_RS16655 (3402410) 3402410..3403726 + 1317 WP_000624747.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NP441_RS16660 (3403790) 3403790..3404677 + 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NP441_RS16665 (3404674) 3404674..3405519 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NP441_RS16670 (3405521) 3405521..3406591 + 1071 WP_000907838.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 3398677..3407328 8651


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(24-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13587.92 Da        Isoelectric Point: 7.3190

>T252873 WP_001521773.1 NZ_CP101907:3401783-3402151 [Salmonella enterica subsp. enterica]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLKQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8152.14 Da        Isoelectric Point: 5.0775

>AT252873 WP_001520924.1 NZ_CP101907:3401565-3401786 [Salmonella enterica subsp. enterica]
MRTVNYSEARQNLAEVLESAVTGGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A607IPC3

Antitoxin

Source ID Structure
AlphaFold DB A0A6C6Z871

References