252492

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 2083770..2084356 Replicon chromosome
Accession NZ_CP101689
Organism Salmonella enterica subsp. enterica serovar Mbandaka strain SMEH

Toxin (Protein)


Gene name doc Uniprot ID Q57IR9
Locus tag NOV91_RS10295 Protein ID WP_000174963.1
Coordinates 2083770..2084138 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID M7SDJ3
Locus tag NOV91_RS10300 Protein ID WP_001520924.1
Coordinates 2084135..2084356 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NOV91_RS10275 (2079288) 2079288..2080358 - 1071 WP_000907842.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
NOV91_RS10280 (2080361) 2080361..2081206 - 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NOV91_RS10285 (2081203) 2081203..2082090 - 888 WP_000094074.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NOV91_RS10290 (2082195) 2082195..2083511 - 1317 WP_000624747.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NOV91_RS10295 (2083770) 2083770..2084138 - 369 WP_000174963.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NOV91_RS10300 (2084135) 2084135..2084356 - 222 WP_001520924.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NOV91_RS10305 (2084487) 2084487..2085200 - 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NOV91_RS10310 (2085202) 2085202..2085969 - 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NOV91_RS10315 (2085966) 2085966..2087243 - 1278 WP_000803764.1 branched chain amino acid ABC transporter permease LivM -
NOV91_RS10320 (2087240) 2087240..2088166 - 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NOV91_RS10325 (2088226) 2088226..2089335 - 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 2078551..2087243 8692


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-122)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13573.85 Da        Isoelectric Point: 6.7252

>T252492 WP_000174963.1 NZ_CP101689:c2084138-2083770 [Salmonella enterica subsp. enterica serovar Mbandaka]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8152.14 Da        Isoelectric Point: 5.0775

>AT252492 WP_001520924.1 NZ_CP101689:c2084356-2084135 [Salmonella enterica subsp. enterica serovar Mbandaka]
MRTVNYSEARQNLAEVLESAVTGGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5H6KCD5

Antitoxin

Source ID Structure
AlphaFold DB A0A6C6Z871

References