251991

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 888854..889440 Replicon chromosome
Accession NZ_CP101375
Organism Salmonella enterica strain SC2016090

Toxin (Protein)


Gene name doc Uniprot ID E8XF70
Locus tag NMU33_RS04305 Protein ID WP_001521773.1
Coordinates 889072..889440 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID M7SDJ3
Locus tag NMU33_RS04300 Protein ID WP_001520924.1
Coordinates 888854..889075 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMU33_RS04275 (883874) 883874..884983 + 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
NMU33_RS04280 (885043) 885043..885969 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NMU33_RS04285 (885966) 885966..887243 + 1278 WP_000803766.1 branched chain amino acid ABC transporter permease LivM -
NMU33_RS04290 (887240) 887240..888007 + 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NMU33_RS04295 (888009) 888009..888722 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NMU33_RS04300 (888854) 888854..889075 + 222 WP_001520924.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NMU33_RS04305 (889072) 889072..889440 + 369 WP_001521773.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NMU33_RS04310 (889699) 889699..891015 + 1317 WP_000624747.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NMU33_RS04315 (891079) 891079..891966 + 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NMU33_RS04320 (891963) 891963..892808 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NMU33_RS04325 (892810) 892810..893880 + 1071 WP_000907838.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 885966..894617 8651


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(24-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13587.92 Da        Isoelectric Point: 7.3190

>T251991 WP_001521773.1 NZ_CP101375:889072-889440 [Salmonella enterica]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLKQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8152.14 Da        Isoelectric Point: 5.0775

>AT251991 WP_001520924.1 NZ_CP101375:888854-889075 [Salmonella enterica]
MRTVNYSEARQNLAEVLESAVTGGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A607IPC3

Antitoxin

Source ID Structure
AlphaFold DB A0A6C6Z871

References