251322

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 311113..311699 Replicon chromosome
Accession NZ_CP100744
Organism Salmonella enterica subsp. enterica serovar Newport strain R18.0234

Toxin (Protein)


Gene name doc Uniprot ID A0A0R9MYB2
Locus tag FGU68_RS01415 Protein ID WP_000174966.1
Coordinates 311331..311699 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0R9PI96
Locus tag FGU68_RS01410 Protein ID WP_001535398.1
Coordinates 311113..311334 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FGU68_RS01385 (306133) 306133..307242 + 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
FGU68_RS01390 (307302) 307302..308228 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
FGU68_RS01395 (308225) 308225..309502 + 1278 WP_000803766.1 branched chain amino acid ABC transporter permease LivM -
FGU68_RS01400 (309499) 309499..310266 + 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
FGU68_RS01405 (310268) 310268..310981 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
FGU68_RS01410 (311113) 311113..311334 + 222 WP_001535398.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
FGU68_RS01415 (311331) 311331..311699 + 369 WP_000174966.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
FGU68_RS01420 (311958) 311958..313274 + 1317 WP_000624747.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
FGU68_RS01425 (313379) 313379..314266 + 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
FGU68_RS01430 (314263) 314263..315108 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
FGU68_RS01435 (315111) 315111..316181 + 1071 WP_000907845.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 308225..316918 8693
- inside Prophage - - 283935..316918 32983


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-122)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13629.91 Da        Isoelectric Point: 6.4657

>T251322 WP_000174966.1 NZ_CP100744:311331-311699 [Salmonella enterica subsp. enterica serovar Newport]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLTISRGYIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8165.23 Da        Isoelectric Point: 6.4643

>AT251322 WP_001535398.1 NZ_CP100744:311113-311334 [Salmonella enterica subsp. enterica serovar Newport]
MRTVNYSEARQNLAEVLESAVTAGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRKLADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0R9MYB2

Antitoxin

Source ID Structure
AlphaFold DB A0A0R9PI96

References