251129

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 316507..317093 Replicon chromosome
Accession NZ_CP100707
Organism Salmonella enterica subsp. enterica serovar Typhimurium strain R18.0409

Toxin (Protein)


Gene name doc Uniprot ID E8XF70
Locus tag NL735_RS01450 Protein ID WP_001521773.1
Coordinates 316725..317093 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID M7SDJ3
Locus tag NL735_RS01445 Protein ID WP_001520924.1
Coordinates 316507..316728 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL735_RS01420 (311527) 311527..312636 + 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
NL735_RS01425 (312696) 312696..313622 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NL735_RS01430 (313619) 313619..314896 + 1278 WP_000803766.1 branched chain amino acid ABC transporter permease LivM -
NL735_RS01435 (314893) 314893..315660 + 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NL735_RS01440 (315662) 315662..316375 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NL735_RS01445 (316507) 316507..316728 + 222 WP_001520924.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NL735_RS01450 (316725) 316725..317093 + 369 WP_001521773.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NL735_RS01455 (317352) 317352..318668 + 1317 WP_000624747.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NL735_RS01460 (318732) 318732..319619 + 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NL735_RS01465 (319616) 319616..320461 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NL735_RS01470 (320463) 320463..321533 + 1071 WP_000907838.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 313619..322270 8651


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(24-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13587.92 Da        Isoelectric Point: 7.3190

>T251129 WP_001521773.1 NZ_CP100707:316725-317093 [Salmonella enterica subsp. enterica serovar Typhimurium]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLKQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8152.14 Da        Isoelectric Point: 5.0775

>AT251129 WP_001520924.1 NZ_CP100707:316507-316728 [Salmonella enterica subsp. enterica serovar Typhimurium]
MRTVNYSEARQNLAEVLESAVTGGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A607IPC3

Antitoxin

Source ID Structure
AlphaFold DB A0A6C6Z871

References