Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 401720..402306 Replicon chromosome
Accession NZ_CP100691
Organism Salmonella enterica subsp. enterica serovar Typhimurium strain R17.3867

Toxin (Protein)


Gene name doc Uniprot ID E8XF70
Locus tag NL690_RS01895 Protein ID WP_001521773.1
Coordinates 401938..402306 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID M7SDJ3
Locus tag NL690_RS01890 Protein ID WP_001520924.1
Coordinates 401720..401941 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL690_RS01865 (396741) 396741..397850 + 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
NL690_RS01870 (397910) 397910..398836 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NL690_RS01875 (398833) 398833..400110 + 1278 WP_000803766.1 branched chain amino acid ABC transporter permease LivM -
NL690_RS01880 (400107) 400107..400874 + 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NL690_RS01885 (400876) 400876..401589 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NL690_RS01890 (401720) 401720..401941 + 222 WP_001520924.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NL690_RS01895 (401938) 401938..402306 + 369 WP_001521773.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NL690_RS01900 (402565) 402565..403881 + 1317 WP_099949595.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NL690_RS01905 (403945) 403945..404832 + 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NL690_RS01910 (404829) 404829..405674 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NL690_RS01915 (405676) 405676..406746 + 1071 WP_000907838.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 398833..407483 8650
- inside Prophage - - 391500..407483 15983


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(24-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13587.92 Da        Isoelectric Point: 7.3190

>T251035 WP_001521773.1 NZ_CP100691:401938-402306 [Salmonella enterica subsp. enterica serovar Typhimurium]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLKQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8152.14 Da        Isoelectric Point: 5.0775

>AT251035 WP_001520924.1 NZ_CP100691:401720-401941 [Salmonella enterica subsp. enterica serovar Typhimurium]
MRTVNYSEARQNLAEVLESAVTGGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A607IPC3

Antitoxin

Source ID Structure
AlphaFold DB A0A6C6Z871

References