Detailed information of TA system TA250932

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): tacAT/DUF1778(antitoxin)
• Location: 3499662..3500476
• Replicon: chromosome
• Accession: NZ_CP100666
• Organism: Salmonella enterica subsp. enterica serovar Enteritidis strain R18.1630

Toxin (Protein)

• Gene name: TacT3
• Uniprot ID: Q57KM2
• Locus tag: NL709_RS17150
• Protein ID: WP_000971655.1
• Coordinates: 3499949..3500476 (+)
• Length: 176 a.a.

Antitoxin (Protein)

• Gene name: TacA3
• Uniprot ID: M7S6I2
• Locus tag: NL709_RS17145
• Protein ID: WP_000855694.1
• Coordinates: 3499662..3499952 (+)
• Length: 97 a.a.

Genomic Context

Location: 3498356..3498799 (444 bp)
Type: Others
Protein ID: WP_000715097.1

Location: 3499203..3499392 (190 bp)
Type: Others
Protein ID: Protein_3340

Location: 3499662..3499952 (291 bp)
Type: Antitoxin
Protein ID: WP_000855694.1

Location: 3499949..3500476 (528 bp)
Type: Toxin
Protein ID: WP_000971655.1

Location: 3501113..3501769 (657 bp)
Type: Others
Protein ID: WP_000420452.1

Location: 3495565..3497253 (1689 bp)
Type: Others
Protein ID: WP_000848113.1

Location: 3497250..3497900 (651 bp)
Type: Others
Protein ID: WP_001674874.1

Location: 3500549..3500754 (206 bp)
Type: Others
Protein ID: Protein_3343

Location: 3502014..3502508 (495 bp)
Type: Others
Protein ID: WP_000424949.1

Location: 3502535..3503203 (669 bp)
Type: Others
Protein ID: WP_000445914.1

Location: 3503789..3504187 (399 bp)
Type: Others
Protein ID: Protein_3347

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NL709_RS17125 (3495565)	3495565..3497253	-	1689	WP_000848113.1	type III secretion system outer membrane ring protein InvG	-
NL709_RS17130 (3497250)	3497250..3497900	-	651	WP_001674874.1	type III secretion system transcriptional activator InvF	-
NL709_RS17135 (3498356)	3498356..3498799	+	444	WP_000715097.1	SPI-1 type III secretion system invasion lipoprotein InvH	-
NL709_RS17140 (3499203)	3499203..3499392	+	190	Protein_3340	IS3 family transposase	-
NL709_RS17145 (3499662)	3499662..3499952	+	291	WP_000855694.1	DUF1778 domain-containing protein	Antitoxin
NL709_RS17150 (3499949)	3499949..3500476	+	528	WP_000971655.1	GNAT family N-acetyltransferase	Toxin
NL709_RS17155 (3500549)	3500549..3500754	-	206	Protein_3343	IS5/IS1182 family transposase	-
NL709_RS17160 (3501113)	3501113..3501769	+	657	WP_000420452.1	protein-serine/threonine phosphatase	-
NL709_RS17165 (3502014)	3502014..3502508	-	495	WP_000424949.1	hypothetical protein	-
NL709_RS17170 (3502535)	3502535..3503203	-	669	WP_000445914.1	hypothetical protein	-
NL709_RS17175 (3503789)	3503789..3504187	-	399	Protein_3347	cytoplasmic protein	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_016810 Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 IS/Tn TA025955 3070795..3070971 0.007 View NC_016856 Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S IS/Tn TA026055 3068456..3068632 0.007 View UFRD01000002 Salmonella enterica subsp. enterica serovar Typhimurium strain NCTC12023 IS/Tn TA010052 4599654..4599830 0.007	flank	IS/Tn	-	-	3500549..3500725	176

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

No domain identified.

Antitoxin

• Vibrio phage ICP1, Orf50 (1-95)

Sequences

Toxin

Protein

• Length: 176 a.a.
• Molecular weight: 19069.91 Da
• Isoelectric Point: 9.6420

>T250932 WP_000971655.1 NZ_CP100666:3499949-3500476 [Salmonella enterica subsp. enterica serovar Enteritidis]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL

Nucleotide

• Length: 528 bp

Antitoxin

Protein

• Length: 97 a.a.
• Molecular weight: 10664.50 Da
• Isoelectric Point: 6.3133

>AT250932 WP_000855694.1 NZ_CP100666:3499662-3499952 [Salmonella enterica subsp. enterica serovar Enteritidis]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK

Nucleotide

• Length: 291 bp

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• PDB: 6G96
• PDB: 7AK9

Antitoxin

Loading, please wait

• AlphaFold DB: A0A3V8SJE7