Detailed information of TA system TA250001

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): tacAT/DUF1778(antitoxin)
• Location: 988524..989338
• Replicon: chromosome
• Accession: NZ_CP099973
• Organism: Salmonella enterica subsp. enterica serovar Enteritidis strain SE006

Toxin (Protein)

• Gene name: TacT3
• Uniprot ID: Q57KM2
• Locus tag: NHL55_RS04720
• Protein ID: WP_000971655.1
• Coordinates: 988524..989051 (-)
• Length: 176 a.a.

Antitoxin (Protein)

• Gene name: TacA3
• Uniprot ID: M7S6I2
• Locus tag: NHL55_RS04725
• Protein ID: WP_000855694.1
• Coordinates: 989048..989338 (-)
• Length: 97 a.a.

Genomic Context

Location: 984813..985211 (399 bp)
Type: Others
Protein ID: Protein_919

Location: 985797..986465 (669 bp)
Type: Others
Protein ID: WP_000445914.1

Location: 986492..986986 (495 bp)
Type: Others
Protein ID: WP_000424949.1

Location: 988246..988451 (206 bp)
Type: Others
Protein ID: Protein_923

Location: 991100..991750 (651 bp)
Type: Others
Protein ID: WP_001674874.1

Location: 991747..993435 (1689 bp)
Type: Others
Protein ID: WP_000848113.1

Location: 987231..987887 (657 bp)
Type: Others
Protein ID: WP_000420452.1

Location: 988524..989051 (528 bp)
Type: Toxin
Protein ID: WP_000971655.1

Location: 989048..989338 (291 bp)
Type: Antitoxin
Protein ID: WP_000855694.1

Location: 989608..989797 (190 bp)
Type: Others
Protein ID: Protein_926

Location: 990201..990644 (444 bp)
Type: Others
Protein ID: WP_000715097.1

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NHL55_RS04695 (984813)	984813..985211	+	399	Protein_919	cytoplasmic protein	-
NHL55_RS04700 (985797)	985797..986465	+	669	WP_000445914.1	hypothetical protein	-
NHL55_RS04705 (986492)	986492..986986	+	495	WP_000424949.1	hypothetical protein	-
NHL55_RS04710 (987231)	987231..987887	-	657	WP_000420452.1	protein-serine/threonine phosphatase	-
NHL55_RS04715 (988246)	988246..988451	+	206	Protein_923	IS5/IS1182 family transposase	-
NHL55_RS04720 (988524)	988524..989051	-	528	WP_000971655.1	GNAT family N-acetyltransferase	Toxin
NHL55_RS04725 (989048)	989048..989338	-	291	WP_000855694.1	DUF1778 domain-containing protein	Antitoxin
NHL55_RS04730 (989608)	989608..989797	-	190	Protein_926	IS3 family transposase	-
NHL55_RS04735 (990201)	990201..990644	-	444	WP_000715097.1	SPI-1 type III secretion system invasion lipoprotein InvH	-
NHL55_RS04740 (991100)	991100..991750	+	651	WP_001674874.1	type III secretion system transcriptional activator InvF	-
NHL55_RS04745 (991747)	991747..993435	+	1689	WP_000848113.1	type III secretion system outer membrane ring protein InvG	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_016810 Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 IS/Tn TA025955 3070795..3070971 0.007 View NC_016856 Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S IS/Tn TA026055 3068456..3068632 0.007 View UFRD01000002 Salmonella enterica subsp. enterica serovar Typhimurium strain NCTC12023 IS/Tn TA010052 4599654..4599830 0.007	flank	IS/Tn	-	-	988275..988451	176

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

No domain identified.

Antitoxin

• Vibrio phage ICP1, Orf50 (1-95)

Sequences

Toxin

Protein

• Length: 176 a.a.
• Molecular weight: 19069.91 Da
• Isoelectric Point: 9.6420

>T250001 WP_000971655.1 NZ_CP099973:c989051-988524 [Salmonella enterica subsp. enterica serovar Enteritidis]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL

Nucleotide

• Length: 528 bp

Antitoxin

Protein

• Length: 97 a.a.
• Molecular weight: 10664.50 Da
• Isoelectric Point: 6.3133

>AT250001 WP_000855694.1 NZ_CP099973:c989338-989048 [Salmonella enterica subsp. enterica serovar Enteritidis]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK

Nucleotide

• Length: 291 bp

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• PDB: 6G96
• PDB: 7AK9

Antitoxin

Loading, please wait

• AlphaFold DB: A0A3V8SJE7