Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 1107843..1108510 | Replicon | chromosome |
Accession | NZ_CP099588 | ||
Organism | Escherichia coli strain EMG2 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | Q46953 |
Locus tag | NHF38_RS05310 | Protein ID | WP_001094400.1 |
Coordinates | 1107843..1108172 (-) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | P52141 |
Locus tag | NHF38_RS05315 | Protein ID | WP_000072690.1 |
Coordinates | 1108193..1108510 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NHF38_RS05305 (1102899) | 1102899..1107479 | + | 4581 | WP_010723187.1 | adhesin-like autotransporter YpjA/EhaD | - |
NHF38_RS05310 (1107843) | 1107843..1108172 | - | 330 | WP_001094400.1 | type IV toxin-antitoxin system toxin YpjF | Toxin |
NHF38_RS05315 (1108193) | 1108193..1108510 | - | 318 | WP_000072690.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NHF38_RS05320 (1108548) | 1108548..1108748 | - | 201 | WP_001395452.1 | DUF987 domain-containing protein | - |
NHF38_RS05325 (1108757) | 1108757..1109239 | - | 483 | WP_001407480.1 | RadC family protein | - |
NHF38_RS05330 (1109248) | 1109248..1109706 | - | 459 | WP_000211841.1 | antirestriction protein | - |
NHF38_RS05335 (1109809) | 1109809..1109993 | - | 185 | Protein_1051 | DUF905 family protein | - |
NHF38_RS05340 (1110604) | 1110604..1112307 | - | 1704 | WP_000896263.1 | protein YfjW | - |
NHF38_RS05345 (1112449) | 1112449..1113458 | + | 1010 | Protein_1053 | arsenic transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 1098191..1130071 | 31880 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12308.21 Da Isoelectric Point: 7.2761
>T249137 WP_001094400.1 NZ_CP099588:c1108172-1107843 [Escherichia coli]
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A373F4I3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | P52141 |