247953

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 1941439..1942025 Replicon chromosome
Accession NZ_CP098741
Organism Salmonella enterica subsp. enterica serovar Typhimurium strain HJL222

Toxin (Protein)


Gene name doc Uniprot ID E8XF70
Locus tag NCG87_RS09515 Protein ID WP_001521773.1
Coordinates 1941439..1941807 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID M7SDJ3
Locus tag NCG87_RS09520 Protein ID WP_001520924.1
Coordinates 1941804..1942025 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NCG87_RS09495 (1936999) 1936999..1938069 - 1071 WP_000907838.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
NCG87_RS09500 (1938071) 1938071..1938916 - 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NCG87_RS09505 (1938913) 1938913..1939800 - 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NCG87_RS09510 (1939864) 1939864..1941180 - 1317 WP_000624747.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NCG87_RS09515 (1941439) 1941439..1941807 - 369 WP_001521773.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NCG87_RS09520 (1941804) 1941804..1942025 - 222 WP_001520924.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NCG87_RS09525 (1942157) 1942157..1942870 - 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NCG87_RS09530 (1942872) 1942872..1943639 - 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NCG87_RS09535 (1943636) 1943636..1944913 - 1278 WP_000803766.1 branched chain amino acid ABC transporter permease LivM -
NCG87_RS09540 (1944910) 1944910..1945836 - 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NCG87_RS09545 (1945896) 1945896..1947005 - 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 1936262..1944913 8651


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(24-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13587.92 Da        Isoelectric Point: 7.3190

>T247953 WP_001521773.1 NZ_CP098741:c1941807-1941439 [Salmonella enterica subsp. enterica serovar Typhimurium]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLKQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8152.14 Da        Isoelectric Point: 5.0775

>AT247953 WP_001520924.1 NZ_CP098741:c1942025-1941804 [Salmonella enterica subsp. enterica serovar Typhimurium]
MRTVNYSEARQNLAEVLESAVTGGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A607IPC3

Antitoxin

Source ID Structure
AlphaFold DB A0A6C6Z871

References