Detailed information of TA system TA247949

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): tacAT/DUF1778(antitoxin)
• Location: 1261000..1261814
• Replicon: chromosome
• Accession: NZ_CP098741
• Organism: Salmonella enterica subsp. enterica serovar Typhimurium strain HJL222

Toxin (Protein)

• Gene name: TacT3
• Uniprot ID: Q57KM2
• Locus tag: NCG87_RS06210
• Protein ID: WP_000971655.1
• Coordinates: 1261287..1261814 (+)
• Length: 176 a.a.

Antitoxin (Protein)

• Gene name: TacA3
• Uniprot ID: E8XL32
• Locus tag: NCG87_RS06205
• Protein ID: WP_000855692.1
• Coordinates: 1261000..1261290 (+)
• Length: 97 a.a.

Genomic Context

Location: 1258057..1258500 (444 bp)
Type: Others
Protein ID: WP_000715092.1

Location: 1258931..1259380 (450 bp)
Type: Others
Protein ID: WP_000381610.1

Location: 1259365..1259712 (348 bp)
Type: Others
Protein ID: WP_001669174.1

Location: 1260552..1260730 (179 bp)
Type: Others
Protein ID: Protein_1205

Location: 1261000..1261290 (291 bp)
Type: Antitoxin
Protein ID: WP_000855692.1

Location: 1261287..1261814 (528 bp)
Type: Toxin
Protein ID: WP_000971655.1

Location: 1262439..1263095 (657 bp)
Type: Others
Protein ID: WP_000420452.1

Location: 1263947..1266514 (2568 bp)
Type: Others
Protein ID: WP_088365275.1

Location: 1256950..1257600 (651 bp)
Type: Others
Protein ID: WP_001674874.1

Location: 1259985..1260311 (327 bp)
Type: Others
Protein ID: WP_000393302.1

Location: 1261887..1262092 (206 bp)
Type: Others
Protein ID: Protein_1208

Location: 1263267..1263788 (522 bp)
Type: Others
Protein ID: WP_000858988.1

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NCG87_RS06175 (1256950)	1256950..1257600	-	651	WP_001674874.1	type III secretion system transcriptional activator InvF	-
NCG87_RS06180 (1258057)	1258057..1258500	+	444	WP_000715092.1	SPI-1 type III secretion system invasion lipoprotein InvH	-
NCG87_RS06185 (1258931)	1258931..1259380	+	450	WP_000381610.1	membrane protein	-
NCG87_RS06190 (1259365)	1259365..1259712	+	348	WP_001669174.1	DUF1493 family protein	-
NCG87_RS06195 (1259985)	1259985..1260311	-	327	WP_000393302.1	hypothetical protein	-
NCG87_RS06200 (1260552)	1260552..1260730	+	179	Protein_1205	IS3 family transposase	-
NCG87_RS06205 (1261000)	1261000..1261290	+	291	WP_000855692.1	DUF1778 domain-containing protein	Antitoxin
NCG87_RS06210 (1261287)	1261287..1261814	+	528	WP_000971655.1	GNAT family N-acetyltransferase	Toxin
NCG87_RS06215 (1261887)	1261887..1262092	-	206	Protein_1208	IS5/IS1182 family transposase	-
NCG87_RS06220 (1262439)	1262439..1263095	+	657	WP_000420452.1	protein-serine/threonine phosphatase	-
NCG87_RS06225 (1263267)	1263267..1263788	-	522	WP_000858988.1	hypothetical protein	-
NCG87_RS06230 (1263947)	1263947..1266514	+	2568	WP_088365275.1	DNA mismatch repair protein MutS	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_016810 Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 IS/Tn TA025955 3070795..3070971 0 View NC_016856 Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S IS/Tn TA026055 3068456..3068632 0 View UFRD01000002 Salmonella enterica subsp. enterica serovar Typhimurium strain NCTC12023 IS/Tn TA010052 4599654..4599830 0	flank	IS/Tn	-	-	1261887..1262063	176

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

No domain identified.

Antitoxin

• Vibrio phage ICP1, Orf50 (1-95)

Sequences

Toxin

Protein

• Length: 176 a.a.
• Molecular weight: 19069.91 Da
• Isoelectric Point: 9.6420

>T247949 WP_000971655.1 NZ_CP098741:1261287-1261814 [Salmonella enterica subsp. enterica serovar Typhimurium]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL

Nucleotide

• Length: 528 bp

Antitoxin

Protein

• Length: 97 a.a.
• Molecular weight: 10678.57 Da
• Isoelectric Point: 8.5779

>AT247949 WP_000855692.1 NZ_CP098741:1261000-1261290 [Salmonella enterica subsp. enterica serovar Typhimurium]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTKMIMEILDNPPAP
NEKLLAAAFALPDMKK

Nucleotide

• Length: 291 bp

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• PDB: 6G96
• PDB: 7AK9

Antitoxin

Loading, please wait

• PDB: 7AK9
• AlphaFold DB: A0A625WHV3