Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1261000..1261814 | Replicon | chromosome |
Accession | NZ_CP098741 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain HJL222 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | Q57KM2 |
Locus tag | NCG87_RS06210 | Protein ID | WP_000971655.1 |
Coordinates | 1261287..1261814 (+) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | E8XL32 |
Locus tag | NCG87_RS06205 | Protein ID | WP_000855692.1 |
Coordinates | 1261000..1261290 (+) | Length | 97 a.a. |
Genomic Context
Location: 1258057..1258500 (444 bp)
Type: Others
Protein ID: WP_000715092.1
Type: Others
Protein ID: WP_000715092.1
Location: 1258931..1259380 (450 bp)
Type: Others
Protein ID: WP_000381610.1
Type: Others
Protein ID: WP_000381610.1
Location: 1259365..1259712 (348 bp)
Type: Others
Protein ID: WP_001669174.1
Type: Others
Protein ID: WP_001669174.1
Location: 1260552..1260730 (179 bp)
Type: Others
Protein ID: Protein_1205
Type: Others
Protein ID: Protein_1205
Location: 1261000..1261290 (291 bp)
Type: Antitoxin
Protein ID: WP_000855692.1
Type: Antitoxin
Protein ID: WP_000855692.1
Location: 1261287..1261814 (528 bp)
Type: Toxin
Protein ID: WP_000971655.1
Type: Toxin
Protein ID: WP_000971655.1
Location: 1262439..1263095 (657 bp)
Type: Others
Protein ID: WP_000420452.1
Type: Others
Protein ID: WP_000420452.1
Location: 1263947..1266514 (2568 bp)
Type: Others
Protein ID: WP_088365275.1
Type: Others
Protein ID: WP_088365275.1
Location: 1256950..1257600 (651 bp)
Type: Others
Protein ID: WP_001674874.1
Type: Others
Protein ID: WP_001674874.1
Location: 1259985..1260311 (327 bp)
Type: Others
Protein ID: WP_000393302.1
Type: Others
Protein ID: WP_000393302.1
Location: 1261887..1262092 (206 bp)
Type: Others
Protein ID: Protein_1208
Type: Others
Protein ID: Protein_1208
Location: 1263267..1263788 (522 bp)
Type: Others
Protein ID: WP_000858988.1
Type: Others
Protein ID: WP_000858988.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NCG87_RS06175 (1256950) | 1256950..1257600 | - | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
NCG87_RS06180 (1258057) | 1258057..1258500 | + | 444 | WP_000715092.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
NCG87_RS06185 (1258931) | 1258931..1259380 | + | 450 | WP_000381610.1 | membrane protein | - |
NCG87_RS06190 (1259365) | 1259365..1259712 | + | 348 | WP_001669174.1 | DUF1493 family protein | - |
NCG87_RS06195 (1259985) | 1259985..1260311 | - | 327 | WP_000393302.1 | hypothetical protein | - |
NCG87_RS06200 (1260552) | 1260552..1260730 | + | 179 | Protein_1205 | IS3 family transposase | - |
NCG87_RS06205 (1261000) | 1261000..1261290 | + | 291 | WP_000855692.1 | DUF1778 domain-containing protein | Antitoxin |
NCG87_RS06210 (1261287) | 1261287..1261814 | + | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
NCG87_RS06215 (1261887) | 1261887..1262092 | - | 206 | Protein_1208 | IS5/IS1182 family transposase | - |
NCG87_RS06220 (1262439) | 1262439..1263095 | + | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
NCG87_RS06225 (1263267) | 1263267..1263788 | - | 522 | WP_000858988.1 | hypothetical protein | - |
NCG87_RS06230 (1263947) | 1263947..1266514 | + | 2568 | WP_088365275.1 | DNA mismatch repair protein MutS | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 1261887..1262063 | 176 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T247949 WP_000971655.1 NZ_CP098741:1261287-1261814 [Salmonella enterica subsp. enterica serovar Typhimurium]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10678.57 Da Isoelectric Point: 8.5779
>AT247949 WP_000855692.1 NZ_CP098741:1261000-1261290 [Salmonella enterica subsp. enterica serovar Typhimurium]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTKMIMEILDNPPAP
NEKLLAAAFALPDMKK
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTKMIMEILDNPPAP
NEKLLAAAFALPDMKK
Download Length: 291 bp