Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 357085..357671 Replicon chromosome
Accession NZ_CP098438
Organism Salmonella enterica subsp. enterica serovar Typhimurium strain ATOMSal-L6

Toxin (Protein)


Gene name doc Uniprot ID E8XF70
Locus tag M9193_RS01645 Protein ID WP_001521773.1
Coordinates 357303..357671 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID M7SDJ3
Locus tag M9193_RS01640 Protein ID WP_001520924.1
Coordinates 357085..357306 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9193_RS01615 (352105) 352105..353214 + 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
M9193_RS01620 (353274) 353274..354200 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
M9193_RS01625 (354197) 354197..355474 + 1278 WP_000803766.1 branched chain amino acid ABC transporter permease LivM -
M9193_RS01630 (355471) 355471..356238 + 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
M9193_RS01635 (356240) 356240..356953 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
M9193_RS01640 (357085) 357085..357306 + 222 WP_001520924.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M9193_RS01645 (357303) 357303..357671 + 369 WP_001521773.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
M9193_RS01650 (357930) 357930..359246 + 1317 WP_000624747.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
M9193_RS01655 (359310) 359310..360197 + 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
M9193_RS01660 (360194) 360194..361039 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
M9193_RS01665 (361041) 361041..362111 + 1071 WP_000907838.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 354197..362848 8651


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(24-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13587.92 Da        Isoelectric Point: 7.3190

>T247617 WP_001521773.1 NZ_CP098438:357303-357671 [Salmonella enterica subsp. enterica serovar Typhimurium]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLKQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8152.14 Da        Isoelectric Point: 5.0775

>AT247617 WP_001520924.1 NZ_CP098438:357085-357306 [Salmonella enterica subsp. enterica serovar Typhimurium]
MRTVNYSEARQNLAEVLESAVTGGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A607IPC3

Antitoxin

Source ID Structure
AlphaFold DB A0A6C6Z871

References