Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 1105947..1106614 | Replicon | chromosome |
Accession | NZ_CP097881 | ||
Organism | Escherichia coli str. K-12 substr. MG1655 strain K-12 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | Q46953 |
Locus tag | NAG69_RS05310 | Protein ID | WP_001094400.1 |
Coordinates | 1105947..1106276 (-) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | P52141 |
Locus tag | NAG69_RS05315 | Protein ID | WP_000072690.1 |
Coordinates | 1106297..1106614 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NAG69_RS05305 (1101003) | 1101003..1105583 | + | 4581 | WP_010723187.1 | adhesin-like autotransporter YpjA/EhaD | - |
NAG69_RS05310 (1105947) | 1105947..1106276 | - | 330 | WP_001094400.1 | type IV toxin-antitoxin system toxin YpjF | Toxin |
NAG69_RS05315 (1106297) | 1106297..1106614 | - | 318 | WP_000072690.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NAG69_RS05320 (1106652) | 1106652..1106852 | - | 201 | WP_001395452.1 | DUF987 domain-containing protein | - |
NAG69_RS05325 (1106861) | 1106861..1107343 | - | 483 | WP_001407480.1 | RadC family protein | - |
NAG69_RS05330 (1107352) | 1107352..1107810 | - | 459 | WP_000211841.1 | antirestriction protein | - |
NAG69_RS05335 (1107913) | 1107913..1108097 | - | 185 | Protein_1040 | DUF905 domain-containing protein | - |
NAG69_RS05340 (1108708) | 1108708..1110411 | - | 1704 | WP_000896263.1 | protein YfjW | - |
NAG69_RS05345 (1110553) | 1110553..1111562 | + | 1010 | Protein_1042 | arsenic transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 1096295..1128175 | 31880 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12308.21 Da Isoelectric Point: 7.2761
>T246413 WP_001094400.1 NZ_CP097881:c1106276-1105947 [Escherichia coli str. K-12 substr. MG1655]
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
Download Length: 330 bp
Antitoxin
Download Length: 106 a.a. Molecular weight: 11737.27 Da Isoelectric Point: 6.4630
>AT246413 WP_000072690.1 NZ_CP097881:c1106614-1106297 [Escherichia coli str. K-12 substr. MG1655]
MSNTTWGLQRDITPRLGARLVQEGNQLHYLADRASITGKFSDAECPKLDVVFPHFISQIESMLTTGELNPRHAQCVTLYH
NGFTCEADTLGSCGYVYIAVYPTQR
MSNTTWGLQRDITPRLGARLVQEGNQLHYLADRASITGKFSDAECPKLDVVFPHFISQIESMLTTGELNPRHAQCVTLYH
NGFTCEADTLGSCGYVYIAVYPTQR
Download Length: 318 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A373F4I3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | P52141 |