Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 988398..989212 | Replicon | chromosome |
| Accession | NZ_CP097262 | ||
| Organism | Salmonella enterica subsp. enterica strain B3-6 | ||
Toxin (Protein)
| Gene name | TacT3 | Uniprot ID | Q57KM2 |
| Locus tag | M3N94_RS04710 | Protein ID | WP_000971655.1 |
| Coordinates | 988398..988925 (-) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | TacA3 | Uniprot ID | M7S6I2 |
| Locus tag | M3N94_RS04715 | Protein ID | WP_000855694.1 |
| Coordinates | 988922..989212 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3N94_RS04685 (984687) | 984687..985085 | + | 399 | Protein_917 | cytoplasmic protein | - |
| M3N94_RS04690 (985671) | 985671..986339 | + | 669 | WP_000445914.1 | hypothetical protein | - |
| M3N94_RS04695 (986366) | 986366..986860 | + | 495 | WP_000424949.1 | hypothetical protein | - |
| M3N94_RS04700 (987105) | 987105..987761 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
| M3N94_RS04705 (988120) | 988120..988325 | + | 206 | Protein_921 | IS5/IS1182 family transposase | - |
| M3N94_RS04710 (988398) | 988398..988925 | - | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
| M3N94_RS04715 (988922) | 988922..989212 | - | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
| M3N94_RS04720 (989482) | 989482..989671 | - | 190 | Protein_924 | IS3 family transposase | - |
| M3N94_RS04725 (990075) | 990075..990518 | - | 444 | WP_000715097.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
| M3N94_RS04730 (990974) | 990974..991624 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
| M3N94_RS04735 (991621) | 991621..993309 | + | 1689 | WP_000848113.1 | type III secretion system outer membrane ring protein InvG | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| flank | IS/Tn | - | - | 988149..988325 | 176 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T245076 WP_000971655.1 NZ_CP097262:c988925-988398 [Salmonella enterica subsp. enterica]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6G96 | |
| PDB | 7AK9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3V8SJE7 |