Detailed information of TA system TA222021

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): tacAT/DUF1778(antitoxin)
• Location: 3377495..3378309
• Replicon: chromosome
• Accession: NZ_CP085821
• Organism: Salmonella enterica subsp. enterica serovar Enteritidis strain Charizard

Toxin (Protein)

• Gene name: TacT3
• Uniprot ID: Q57KM2
• Locus tag: LJF63_RS16600
• Protein ID: WP_000971655.1
• Coordinates: 3377782..3378309 (+)
• Length: 176 a.a.

Antitoxin (Protein)

• Gene name: TacA3
• Uniprot ID: M7S6I2
• Locus tag: LJF63_RS16595
• Protein ID: WP_000855694.1
• Coordinates: 3377495..3377785 (+)
• Length: 97 a.a.

Genomic Context

Location: 3376189..3376632 (444 bp)
Type: Others
Protein ID: WP_000715097.1

Location: 3377036..3377225 (190 bp)
Type: Others
Protein ID: Protein_3243

Location: 3377495..3377785 (291 bp)
Type: Antitoxin
Protein ID: WP_000855694.1

Location: 3377782..3378309 (528 bp)
Type: Toxin
Protein ID: WP_000971655.1

Location: 3378946..3379602 (657 bp)
Type: Others
Protein ID: WP_000420452.1

Location: 3373398..3375086 (1689 bp)
Type: Others
Protein ID: WP_000848113.1

Location: 3375083..3375733 (651 bp)
Type: Others
Protein ID: WP_001674874.1

Location: 3378382..3378587 (206 bp)
Type: Others
Protein ID: Protein_3246

Location: 3379847..3380341 (495 bp)
Type: Others
Protein ID: WP_000424949.1

Location: 3380368..3381036 (669 bp)
Type: Others
Protein ID: WP_000445914.1

Location: 3381622..3382020 (399 bp)
Type: Others
Protein ID: Protein_3250

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
LJF63_RS16575 (3373398)	3373398..3375086	-	1689	WP_000848113.1	type III secretion system outer membrane ring protein InvG	-
LJF63_RS16580 (3375083)	3375083..3375733	-	651	WP_001674874.1	type III secretion system transcriptional activator InvF	-
LJF63_RS16585 (3376189)	3376189..3376632	+	444	WP_000715097.1	SPI-1 type III secretion system invasion lipoprotein InvH	-
LJF63_RS16590 (3377036)	3377036..3377225	+	190	Protein_3243	IS3 family transposase	-
LJF63_RS16595 (3377495)	3377495..3377785	+	291	WP_000855694.1	DUF1778 domain-containing protein	Antitoxin
LJF63_RS16600 (3377782)	3377782..3378309	+	528	WP_000971655.1	GNAT family N-acetyltransferase	Toxin
LJF63_RS16605 (3378382)	3378382..3378587	-	206	Protein_3246	IS5/IS1182 family transposase	-
LJF63_RS16610 (3378946)	3378946..3379602	+	657	WP_000420452.1	protein-serine/threonine phosphatase	-
LJF63_RS16615 (3379847)	3379847..3380341	-	495	WP_000424949.1	hypothetical protein	-
LJF63_RS16620 (3380368)	3380368..3381036	-	669	WP_000445914.1	hypothetical protein	-
LJF63_RS16625 (3381622)	3381622..3382020	-	399	Protein_3250	cytoplasmic protein	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_016810 Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 IS/Tn TA025955 3070795..3070971 0.007 View NC_016856 Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S IS/Tn TA026055 3068456..3068632 0.007 View UFRD01000002 Salmonella enterica subsp. enterica serovar Typhimurium strain NCTC12023 IS/Tn TA010052 4599654..4599830 0.007	flank	IS/Tn	-	-	3378382..3378558	176

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

No domain identified.

Antitoxin

• Vibrio phage ICP1, Orf50 (1-95)

Sequences

Toxin

Protein

• Length: 176 a.a.
• Molecular weight: 19069.91 Da
• Isoelectric Point: 9.6420

>T222021 WP_000971655.1 NZ_CP085821:3377782-3378309 [Salmonella enterica subsp. enterica serovar Enteritidis]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL

Nucleotide

• Length: 528 bp

>T222021 NZ_CP117659:159798-159950 [Escherichia albertii]
ATGCCGCAGAAATATAGATTGCTTTCTTTAATAGTGATTTGTTTCACGCTTTTATTTTTCACCTGGATGATAAGGGATTC
ACTGTGTGAATTGCATATTAAACAGGGGAGTTATGAGCTGGCGGCGTTTTTAGCCTGCAATTTGAAAGAGTAA

Antitoxin

Protein

• Length: 97 a.a.
• Molecular weight: 10664.50 Da
• Isoelectric Point: 6.3133

>AT222021 WP_000855694.1 NZ_CP085821:3377495-3377785 [Salmonella enterica subsp. enterica serovar Enteritidis]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK

Nucleotide

• Length: 291 bp

>AT222021 NZ_CP117659:c159747-159693 [Escherichia albertii]
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• PDB: 6G96
• PDB: 7AK9

Antitoxin

Loading, please wait

• AlphaFold DB: A0A3V8SJE7