Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 139263..140077 | Replicon | chromosome |
Accession | NZ_CP047555 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain SJTUF10112 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | Q57KM2 |
Locus tag | DXN18_RS00725 | Protein ID | WP_000971655.1 |
Coordinates | 139550..140077 (+) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | E8XL32 |
Locus tag | DXN18_RS00720 | Protein ID | WP_000855692.1 |
Coordinates | 139263..139553 (+) | Length | 97 a.a. |
Genomic Context
Location: 136320..136763 (444 bp)
Type: Others
Protein ID: WP_000715092.1
Type: Others
Protein ID: WP_000715092.1
Location: 137194..137643 (450 bp)
Type: Others
Protein ID: WP_000381610.1
Type: Others
Protein ID: WP_000381610.1
Location: 137628..137975 (348 bp)
Type: Others
Protein ID: WP_001669174.1
Type: Others
Protein ID: WP_001669174.1
Location: 138815..138993 (179 bp)
Type: Others
Protein ID: Protein_137
Type: Others
Protein ID: Protein_137
Location: 139263..139553 (291 bp)
Type: Antitoxin
Protein ID: WP_000855692.1
Type: Antitoxin
Protein ID: WP_000855692.1
Location: 139550..140077 (528 bp)
Type: Toxin
Protein ID: WP_000971655.1
Type: Toxin
Protein ID: WP_000971655.1
Location: 140702..141358 (657 bp)
Type: Others
Protein ID: WP_000420452.1
Type: Others
Protein ID: WP_000420452.1
Location: 142210..144777 (2568 bp)
Type: Others
Protein ID: WP_001005807.1
Type: Others
Protein ID: WP_001005807.1
Location: 135213..135863 (651 bp)
Type: Others
Protein ID: WP_001674874.1
Type: Others
Protein ID: WP_001674874.1
Location: 138248..138574 (327 bp)
Type: Others
Protein ID: WP_000393302.1
Type: Others
Protein ID: WP_000393302.1
Location: 140150..140355 (206 bp)
Type: Others
Protein ID: Protein_140
Type: Others
Protein ID: Protein_140
Location: 141530..142051 (522 bp)
Type: Others
Protein ID: WP_000858988.1
Type: Others
Protein ID: WP_000858988.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXN18_RS00690 (135213) | 135213..135863 | - | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
DXN18_RS00695 (136320) | 136320..136763 | + | 444 | WP_000715092.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
DXN18_RS00700 (137194) | 137194..137643 | + | 450 | WP_000381610.1 | membrane protein | - |
DXN18_RS00705 (137628) | 137628..137975 | + | 348 | WP_001669174.1 | DUF1493 family protein | - |
DXN18_RS00710 (138248) | 138248..138574 | - | 327 | WP_000393302.1 | hypothetical protein | - |
DXN18_RS00715 (138815) | 138815..138993 | + | 179 | Protein_137 | IS3 family transposase | - |
DXN18_RS00720 (139263) | 139263..139553 | + | 291 | WP_000855692.1 | DUF1778 domain-containing protein | Antitoxin |
DXN18_RS00725 (139550) | 139550..140077 | + | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
DXN18_RS00730 (140150) | 140150..140355 | - | 206 | Protein_140 | IS5/IS1182 family transposase | - |
DXN18_RS00735 (140702) | 140702..141358 | + | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
DXN18_RS00740 (141530) | 141530..142051 | - | 522 | WP_000858988.1 | hypothetical protein | - |
DXN18_RS00745 (142210) | 142210..144777 | + | 2568 | WP_001005807.1 | DNA mismatch repair protein MutS | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 140150..140326 | 176 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T146687 WP_000971655.1 NZ_CP047555:139550-140077 [Salmonella enterica subsp. enterica serovar Typhimurium]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
>T146687 NZ_CP062774:283379-283486 [Escherichia coli O157:H7]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 97 a.a. Molecular weight: 10678.57 Da Isoelectric Point: 8.5779
>AT146687 WP_000855692.1 NZ_CP047555:139263-139553 [Salmonella enterica subsp. enterica serovar Typhimurium]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTKMIMEILDNPPAP
NEKLLAAAFALPDMKK
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTKMIMEILDNPPAP
NEKLLAAAFALPDMKK
Download Length: 291 bp
>AT146687 NZ_CP062774:c283331-283265 [Escherichia coli O157:H7]
GGTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GGTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT