Detailed information of TA system TA146687

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): tacAT/DUF1778(antitoxin)
• Location: 139263..140077
• Replicon: chromosome
• Accession: NZ_CP047555
• Organism: Salmonella enterica subsp. enterica serovar Typhimurium strain SJTUF10112

Toxin (Protein)

• Gene name: TacT3
• Uniprot ID: Q57KM2
• Locus tag: DXN18_RS00725
• Protein ID: WP_000971655.1
• Coordinates: 139550..140077 (+)
• Length: 176 a.a.

Antitoxin (Protein)

• Gene name: TacA3
• Uniprot ID: E8XL32
• Locus tag: DXN18_RS00720
• Protein ID: WP_000855692.1
• Coordinates: 139263..139553 (+)
• Length: 97 a.a.

Genomic Context

Location: 136320..136763 (444 bp)
Type: Others
Protein ID: WP_000715092.1

Location: 137194..137643 (450 bp)
Type: Others
Protein ID: WP_000381610.1

Location: 137628..137975 (348 bp)
Type: Others
Protein ID: WP_001669174.1

Location: 138815..138993 (179 bp)
Type: Others
Protein ID: Protein_137

Location: 139263..139553 (291 bp)
Type: Antitoxin
Protein ID: WP_000855692.1

Location: 139550..140077 (528 bp)
Type: Toxin
Protein ID: WP_000971655.1

Location: 140702..141358 (657 bp)
Type: Others
Protein ID: WP_000420452.1

Location: 142210..144777 (2568 bp)
Type: Others
Protein ID: WP_001005807.1

Location: 135213..135863 (651 bp)
Type: Others
Protein ID: WP_001674874.1

Location: 138248..138574 (327 bp)
Type: Others
Protein ID: WP_000393302.1

Location: 140150..140355 (206 bp)
Type: Others
Protein ID: Protein_140

Location: 141530..142051 (522 bp)
Type: Others
Protein ID: WP_000858988.1

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
DXN18_RS00690 (135213)	135213..135863	-	651	WP_001674874.1	type III secretion system transcriptional activator InvF	-
DXN18_RS00695 (136320)	136320..136763	+	444	WP_000715092.1	SPI-1 type III secretion system invasion lipoprotein InvH	-
DXN18_RS00700 (137194)	137194..137643	+	450	WP_000381610.1	membrane protein	-
DXN18_RS00705 (137628)	137628..137975	+	348	WP_001669174.1	DUF1493 family protein	-
DXN18_RS00710 (138248)	138248..138574	-	327	WP_000393302.1	hypothetical protein	-
DXN18_RS00715 (138815)	138815..138993	+	179	Protein_137	IS3 family transposase	-
DXN18_RS00720 (139263)	139263..139553	+	291	WP_000855692.1	DUF1778 domain-containing protein	Antitoxin
DXN18_RS00725 (139550)	139550..140077	+	528	WP_000971655.1	GNAT family N-acetyltransferase	Toxin
DXN18_RS00730 (140150)	140150..140355	-	206	Protein_140	IS5/IS1182 family transposase	-
DXN18_RS00735 (140702)	140702..141358	+	657	WP_000420452.1	protein-serine/threonine phosphatase	-
DXN18_RS00740 (141530)	141530..142051	-	522	WP_000858988.1	hypothetical protein	-
DXN18_RS00745 (142210)	142210..144777	+	2568	WP_001005807.1	DNA mismatch repair protein MutS	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_016810 Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 IS/Tn TA025955 3070795..3070971 0 View NC_016856 Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S IS/Tn TA026055 3068456..3068632 0 View UFRD01000002 Salmonella enterica subsp. enterica serovar Typhimurium strain NCTC12023 IS/Tn TA010052 4599654..4599830 0	flank	IS/Tn	-	-	140150..140326	176

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

No domain identified.

Antitoxin

• Vibrio phage ICP1, Orf50 (1-95)

Sequences

Toxin

Protein

• Length: 176 a.a.
• Molecular weight: 19069.91 Da
• Isoelectric Point: 9.6420

>T146687 WP_000971655.1 NZ_CP047555:139550-140077 [Salmonella enterica subsp. enterica serovar Typhimurium]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL

Nucleotide

• Length: 528 bp

>T146687 NZ_CP062774:283379-283486 [Escherichia coli O157:H7]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA

Antitoxin

Protein

• Length: 97 a.a.
• Molecular weight: 10678.57 Da
• Isoelectric Point: 8.5779

>AT146687 WP_000855692.1 NZ_CP047555:139263-139553 [Salmonella enterica subsp. enterica serovar Typhimurium]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTKMIMEILDNPPAP
NEKLLAAAFALPDMKK

Nucleotide

• Length: 291 bp

>AT146687 NZ_CP062774:c283331-283265 [Escherichia coli O157:H7]
GGTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• PDB: 6G96
• PDB: 7AK9

Antitoxin

Loading, please wait

• PDB: 7AK9
• AlphaFold DB: A0A625WHV3