Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 3960880..3961694 | Replicon | chromosome |
Accession | NZ_CP047548 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain SJTUF10169 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | Q57KM2 |
Locus tag | DXN26_RS19480 | Protein ID | WP_000971655.1 |
Coordinates | 3961167..3961694 (+) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | E8XL32 |
Locus tag | DXN26_RS19475 | Protein ID | WP_000855692.1 |
Coordinates | 3960880..3961170 (+) | Length | 97 a.a. |
Genomic Context
Location: 3957937..3958380 (444 bp)
Type: Others
Protein ID: WP_000715092.1
Type: Others
Protein ID: WP_000715092.1
Location: 3958811..3959260 (450 bp)
Type: Others
Protein ID: WP_000381610.1
Type: Others
Protein ID: WP_000381610.1
Location: 3959245..3959592 (348 bp)
Type: Others
Protein ID: WP_001669174.1
Type: Others
Protein ID: WP_001669174.1
Location: 3960432..3960610 (179 bp)
Type: Others
Protein ID: Protein_3790
Type: Others
Protein ID: Protein_3790
Location: 3960880..3961170 (291 bp)
Type: Antitoxin
Protein ID: WP_000855692.1
Type: Antitoxin
Protein ID: WP_000855692.1
Location: 3961167..3961694 (528 bp)
Type: Toxin
Protein ID: WP_000971655.1
Type: Toxin
Protein ID: WP_000971655.1
Location: 3962319..3962975 (657 bp)
Type: Others
Protein ID: WP_000420452.1
Type: Others
Protein ID: WP_000420452.1
Location: 3963827..3966394 (2568 bp)
Type: Others
Protein ID: WP_001005807.1
Type: Others
Protein ID: WP_001005807.1
Location: 3956830..3957480 (651 bp)
Type: Others
Protein ID: WP_001674874.1
Type: Others
Protein ID: WP_001674874.1
Location: 3959865..3960191 (327 bp)
Type: Others
Protein ID: WP_000393302.1
Type: Others
Protein ID: WP_000393302.1
Location: 3961767..3961972 (206 bp)
Type: Others
Protein ID: Protein_3793
Type: Others
Protein ID: Protein_3793
Location: 3963147..3963668 (522 bp)
Type: Others
Protein ID: WP_000858988.1
Type: Others
Protein ID: WP_000858988.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXN26_RS19445 (3956830) | 3956830..3957480 | - | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
DXN26_RS19450 (3957937) | 3957937..3958380 | + | 444 | WP_000715092.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
DXN26_RS19455 (3958811) | 3958811..3959260 | + | 450 | WP_000381610.1 | membrane protein | - |
DXN26_RS19460 (3959245) | 3959245..3959592 | + | 348 | WP_001669174.1 | DUF1493 family protein | - |
DXN26_RS19465 (3959865) | 3959865..3960191 | - | 327 | WP_000393302.1 | hypothetical protein | - |
DXN26_RS19470 (3960432) | 3960432..3960610 | + | 179 | Protein_3790 | IS3 family transposase | - |
DXN26_RS19475 (3960880) | 3960880..3961170 | + | 291 | WP_000855692.1 | DUF1778 domain-containing protein | Antitoxin |
DXN26_RS19480 (3961167) | 3961167..3961694 | + | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
DXN26_RS19485 (3961767) | 3961767..3961972 | - | 206 | Protein_3793 | IS5/IS1182 family transposase | - |
DXN26_RS19490 (3962319) | 3962319..3962975 | + | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
DXN26_RS19495 (3963147) | 3963147..3963668 | - | 522 | WP_000858988.1 | hypothetical protein | - |
DXN26_RS19500 (3963827) | 3963827..3966394 | + | 2568 | WP_001005807.1 | DNA mismatch repair protein MutS | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 3961767..3961943 | 176 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T146630 WP_000971655.1 NZ_CP047548:3961167-3961694 [Salmonella enterica subsp. enterica serovar Typhimurium]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
>T146630 NZ_CP062769:283379-283486 [Escherichia coli O157:H7]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 97 a.a. Molecular weight: 10678.57 Da Isoelectric Point: 8.5779
>AT146630 WP_000855692.1 NZ_CP047548:3960880-3961170 [Salmonella enterica subsp. enterica serovar Typhimurium]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTKMIMEILDNPPAP
NEKLLAAAFALPDMKK
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTKMIMEILDNPPAP
NEKLLAAAFALPDMKK
Download Length: 291 bp
>AT146630 NZ_CP062769:c283331-283265 [Escherichia coli O157:H7]
GGTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GGTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT