Detailed information of TA system TA146630

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): tacAT/DUF1778(antitoxin)
• Location: 3960880..3961694
• Replicon: chromosome
• Accession: NZ_CP047548
• Organism: Salmonella enterica subsp. enterica serovar Typhimurium strain SJTUF10169

Toxin (Protein)

• Gene name: TacT3
• Uniprot ID: Q57KM2
• Locus tag: DXN26_RS19480
• Protein ID: WP_000971655.1
• Coordinates: 3961167..3961694 (+)
• Length: 176 a.a.

Antitoxin (Protein)

• Gene name: TacA3
• Uniprot ID: E8XL32
• Locus tag: DXN26_RS19475
• Protein ID: WP_000855692.1
• Coordinates: 3960880..3961170 (+)
• Length: 97 a.a.

Genomic Context

Location: 3957937..3958380 (444 bp)
Type: Others
Protein ID: WP_000715092.1

Location: 3958811..3959260 (450 bp)
Type: Others
Protein ID: WP_000381610.1

Location: 3959245..3959592 (348 bp)
Type: Others
Protein ID: WP_001669174.1

Location: 3960432..3960610 (179 bp)
Type: Others
Protein ID: Protein_3790

Location: 3960880..3961170 (291 bp)
Type: Antitoxin
Protein ID: WP_000855692.1

Location: 3961167..3961694 (528 bp)
Type: Toxin
Protein ID: WP_000971655.1

Location: 3962319..3962975 (657 bp)
Type: Others
Protein ID: WP_000420452.1

Location: 3963827..3966394 (2568 bp)
Type: Others
Protein ID: WP_001005807.1

Location: 3956830..3957480 (651 bp)
Type: Others
Protein ID: WP_001674874.1

Location: 3959865..3960191 (327 bp)
Type: Others
Protein ID: WP_000393302.1

Location: 3961767..3961972 (206 bp)
Type: Others
Protein ID: Protein_3793

Location: 3963147..3963668 (522 bp)
Type: Others
Protein ID: WP_000858988.1

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
DXN26_RS19445 (3956830)	3956830..3957480	-	651	WP_001674874.1	type III secretion system transcriptional activator InvF	-
DXN26_RS19450 (3957937)	3957937..3958380	+	444	WP_000715092.1	SPI-1 type III secretion system invasion lipoprotein InvH	-
DXN26_RS19455 (3958811)	3958811..3959260	+	450	WP_000381610.1	membrane protein	-
DXN26_RS19460 (3959245)	3959245..3959592	+	348	WP_001669174.1	DUF1493 family protein	-
DXN26_RS19465 (3959865)	3959865..3960191	-	327	WP_000393302.1	hypothetical protein	-
DXN26_RS19470 (3960432)	3960432..3960610	+	179	Protein_3790	IS3 family transposase	-
DXN26_RS19475 (3960880)	3960880..3961170	+	291	WP_000855692.1	DUF1778 domain-containing protein	Antitoxin
DXN26_RS19480 (3961167)	3961167..3961694	+	528	WP_000971655.1	GNAT family N-acetyltransferase	Toxin
DXN26_RS19485 (3961767)	3961767..3961972	-	206	Protein_3793	IS5/IS1182 family transposase	-
DXN26_RS19490 (3962319)	3962319..3962975	+	657	WP_000420452.1	protein-serine/threonine phosphatase	-
DXN26_RS19495 (3963147)	3963147..3963668	-	522	WP_000858988.1	hypothetical protein	-
DXN26_RS19500 (3963827)	3963827..3966394	+	2568	WP_001005807.1	DNA mismatch repair protein MutS	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_016810 Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 IS/Tn TA025955 3070795..3070971 0 View NC_016856 Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S IS/Tn TA026055 3068456..3068632 0 View UFRD01000002 Salmonella enterica subsp. enterica serovar Typhimurium strain NCTC12023 IS/Tn TA010052 4599654..4599830 0	flank	IS/Tn	-	-	3961767..3961943	176

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

No domain identified.

Antitoxin

• Vibrio phage ICP1, Orf50 (1-95)

Sequences

Toxin

Protein

• Length: 176 a.a.
• Molecular weight: 19069.91 Da
• Isoelectric Point: 9.6420

>T146630 WP_000971655.1 NZ_CP047548:3961167-3961694 [Salmonella enterica subsp. enterica serovar Typhimurium]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL

Nucleotide

• Length: 528 bp

>T146630 NZ_CP062769:283379-283486 [Escherichia coli O157:H7]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA

Antitoxin

Protein

• Length: 97 a.a.
• Molecular weight: 10678.57 Da
• Isoelectric Point: 8.5779

>AT146630 WP_000855692.1 NZ_CP047548:3960880-3961170 [Salmonella enterica subsp. enterica serovar Typhimurium]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTKMIMEILDNPPAP
NEKLLAAAFALPDMKK

Nucleotide

• Length: 291 bp

>AT146630 NZ_CP062769:c283331-283265 [Escherichia coli O157:H7]
GGTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• PDB: 6G96
• PDB: 7AK9

Antitoxin

Loading, please wait

• PDB: 7AK9
• AlphaFold DB: A0A625WHV3