Detailed information    

insolico Bioinformatically predicted

Overview


Name   sxy/tfoX   Type   Regulator
Locus tag   QMG85_RS05895 Genome accession   NZ_AP027162
Coordinates   1222059..1222688 (+) Length   209 a.a.
NCBI ID   WP_000839153.1    Uniprot ID   A0A9Q6Y251
Organism   Escherichia coli strain EH031     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1209556..1247883 1222059..1222688 within 0


Gene organization within MGE regions


Location: 1209556..1247883
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QMG85_RS05845 (BEL031_1124) uup 1210886..1212793 (+) 1908 WP_000053122.1 ABC transporter ATP-binding protein -
  QMG85_RS05850 (BEL031_1125) pqiA 1212923..1214176 (+) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  QMG85_RS05855 (BEL031_1126) pqiB 1214181..1215821 (+) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  QMG85_RS05860 (BEL031_1127) pqiC 1215818..1216381 (+) 564 WP_000759122.1 membrane integrity-associated transporter subunit PqiC -
  QMG85_RS05865 (BEL031_1128) rmf 1216637..1216804 (+) 168 WP_000828648.1 ribosome modulation factor -
  QMG85_RS05870 (BEL031_1129) fabA 1216874..1217392 (-) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  QMG85_RS05875 (BEL031_1130) ycbZ 1217461..1219221 (-) 1761 WP_000156528.1 Lon protease family protein -
  QMG85_RS05880 (BEL031_1131) matP 1219407..1219859 (+) 453 WP_000877161.1 macrodomain Ter protein MatP -
  QMG85_RS05885 (BEL031_1132) ompA 1219934..1220974 (-) 1041 WP_000750416.1 porin OmpA -
  QMG85_RS05890 (BEL031_1133) sulA 1221331..1221840 (-) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  QMG85_RS05895 (BEL031_1134) sxy/tfoX 1222059..1222688 (+) 630 WP_000839153.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  QMG85_RS05900 (BEL031_1135) yccS 1222651..1224813 (-) 2163 WP_000875023.1 YccS family putative transporter -
  QMG85_RS05905 (BEL031_1136) yccF 1224823..1225269 (-) 447 WP_001261235.1 YccF domain-containing protein -
  QMG85_RS05910 (BEL031_1137) helD 1225392..1227446 (+) 2055 WP_001297106.1 DNA helicase IV -
  QMG85_RS05915 (BEL031_1138) mgsA 1227478..1227936 (-) 459 WP_000424181.1 methylglyoxal synthase -
  QMG85_RS05920 (BEL031_1139) yccT 1228032..1228694 (-) 663 WP_000847791.1 DUF2057 family protein -
  QMG85_RS05925 (BEL031_1140) yccU 1228867..1229280 (+) 414 WP_000665217.1 CoA-binding protein -
  QMG85_RS05930 (BEL031_1141) hspQ 1229325..1229642 (-) 318 WP_001295356.1 heat shock protein HspQ -
  QMG85_RS05935 (BEL031_1142) rlmI 1229700..1230890 (-) 1191 WP_000116301.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  QMG85_RS05940 (BEL031_1143) yccX 1230985..1231263 (+) 279 WP_000048244.1 acylphosphatase -
  QMG85_RS05945 (BEL031_1144) tusE 1231260..1231589 (-) 330 WP_000904442.1 sulfurtransferase TusE -
  QMG85_RS05950 (BEL031_1145) yccA 1231680..1232339 (-) 660 WP_000375138.1 FtsH protease modulator YccA -
  QMG85_RS05955 (BEL031_1146) - 1232747..1233766 (-) 1020 WP_099356167.1 tyrosine-type recombinase/integrase -
  QMG85_RS05960 (BEL031_1147) - 1233744..1233986 (-) 243 WP_000273151.1 DUF4224 domain-containing protein -
  QMG85_RS05965 (BEL031_1148) - 1234054..1236504 (-) 2451 WP_000048499.1 exonuclease -
  QMG85_RS05970 - 1236599..1236787 (-) 189 WP_000199475.1 DUF1482 family protein -
  QMG85_RS05975 (BEL031_1149) dicB 1236784..1236972 (-) 189 WP_000449175.1 cell division inhibition protein DicB -
  QMG85_RS05980 (BEL031_1150) - 1237373..1237537 (+) 165 WP_001331716.1 hypothetical protein -
  QMG85_RS05985 (BEL031_1151) ydfC 1237541..1237759 (-) 219 WP_001171921.1 protein YdfC -
  QMG85_RS05990 - 1237831..1238130 (-) 300 WP_012817750.1 hypothetical protein -
  QMG85_RS05995 (BEL031_1153) - 1238466..1238768 (+) 303 WP_000692026.1 type II toxin-antitoxin system HigB family toxin -
  QMG85_RS06000 (BEL031_1154) - 1238771..1239130 (+) 360 WP_001022415.1 helix-turn-helix domain-containing protein -
  QMG85_RS06005 (BEL031_1155) - 1239177..1239569 (-) 393 WP_000578360.1 helix-turn-helix domain-containing protein -
  QMG85_RS06010 (BEL031_1156) - 1239696..1239956 (+) 261 WP_001172789.1 YdaS family helix-turn-helix protein -
  QMG85_RS06015 (BEL031_1157) - 1239953..1240390 (+) 438 WP_000693932.1 toxin YdaT family protein -
  QMG85_RS06020 (BEL031_1158) - 1240477..1241487 (+) 1011 WP_000729535.1 DUF1376 domain-containing protein -
  QMG85_RS06025 (BEL031_1159) - 1241480..1241941 (+) 462 WP_000139444.1 replication protein P -
  QMG85_RS06030 (BEL031_1160) - 1241975..1242700 (+) 726 WP_000450641.1 DUF1627 domain-containing protein -
  QMG85_RS06035 (BEL031_1161) - 1242716..1243108 (+) 393 WP_001040234.1 DUF977 family protein -
  QMG85_RS06040 (BEL031_1162) - 1243105..1243401 (+) 297 WP_001266133.1 DUF4406 domain-containing protein -
  QMG85_RS06045 (BEL031_1163) - 1243398..1243859 (+) 462 WP_001209480.1 sigma-E factor regulatory protein RseB domain-containing protein -
  QMG85_RS06050 (BEL031_1164) - 1243837..1244193 (+) 357 WP_000403783.1 hypothetical protein -
  QMG85_RS06055 (BEL031_1165) - 1244244..1244456 (+) 213 WP_000935422.1 hypothetical protein -
  QMG85_RS06060 (BEL031_1166) - 1244490..1244672 (+) 183 WP_001224662.1 hypothetical protein -
  QMG85_RS06065 (BEL031_1167) - 1244665..1244841 (+) 177 WP_000753069.1 hypothetical protein -
  QMG85_RS06070 (BEL031_1168) - 1244838..1245335 (+) 498 Protein_1190 ead/Ea22-like family protein -
  QMG85_RS06075 (BEL031_1169) - 1245561..1245779 (+) 219 WP_000209152.1 DUF4014 family protein -
  QMG85_RS06080 (BEL031_1170) - 1245781..1246146 (+) 366 WP_001229296.1 HNH endonuclease signature motif containing protein -
  QMG85_RS06085 (BEL031_1171) - 1246143..1246487 (+) 345 WP_000206830.1 hypothetical protein -
  QMG85_RS06090 (BEL031_1172) - 1246692..1246991 (-) 300 WP_000220601.1 type II toxin-antitoxin system RelE/ParE family toxin -
  QMG85_RS06095 (BEL031_1173) - 1246997..1247254 (-) 258 WP_001260977.1 type II toxin-antitoxin system ParD family antitoxin -
  QMG85_RS06100 - 1247390..1247662 (+) 273 WP_001342259.1 hypothetical protein -

Sequence


Protein


Download         Length: 209 a.a.        Molecular weight: 24147.02 Da        Isoelectric Point: 9.2180

>NTDB_id=99791 QMG85_RS05895 WP_000839153.1 1222059..1222688(+) (sxy/tfoX) [Escherichia coli strain EH031]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=99791 QMG85_RS05895 WP_000839153.1 1222059..1222688(+) (sxy/tfoX) [Escherichia coli strain EH031]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

100

100

1


Multiple sequence alignment