Detailed information    

insolico Bioinformatically predicted

Overview

Name   sxy/tfoX   Type   Regulator
Locus tag   QMG94_RS14550 Genome accession   NZ_AP027159
Coordinates   2768678..2769307 (-) Length   209 a.a.
NCBI ID   WP_000839153.1    Uniprot ID   A0A9Q6Y251
Organism   Escherichia coli strain 2313     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 2743483..2781810 2768678..2769307 within 0


Gene organization within MGE regions


Location: 2743483..2781810
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QMG94_RS14345 - 2743704..2743976 (-) 273 WP_001342259.1 hypothetical protein -
  QMG94_RS14350 - 2743945..2744076 (-) 132 WP_001342258.1 hypothetical protein -
  QMG94_RS14355 (T2313_2738) - 2744112..2744369 (+) 258 WP_001260977.1 type II toxin-antitoxin system ParD family antitoxin -
  QMG94_RS14360 (T2313_2739) - 2744375..2744674 (+) 300 WP_000220601.1 type II toxin-antitoxin system RelE/ParE family toxin -
  QMG94_RS14365 (T2313_2740) - 2744879..2745223 (-) 345 WP_000206830.1 hypothetical protein -
  QMG94_RS14370 (T2313_2741) - 2745220..2745585 (-) 366 WP_001229296.1 HNH endonuclease signature motif containing protein -
  QMG94_RS14375 (T2313_2742) - 2745587..2745805 (-) 219 WP_000209152.1 DUF4014 family protein -
  QMG94_RS14380 (T2313_2743) - 2746031..2746528 (-) 498 Protein_2835 ead/Ea22-like family protein -
  QMG94_RS14385 (T2313_2744) - 2746525..2746701 (-) 177 WP_000753069.1 hypothetical protein -
  QMG94_RS14390 (T2313_2745) - 2746694..2746876 (-) 183 WP_001224662.1 hypothetical protein -
  QMG94_RS14395 (T2313_2746) - 2746910..2747122 (-) 213 WP_000935422.1 hypothetical protein -
  QMG94_RS14400 (T2313_2747) - 2747173..2747529 (-) 357 WP_000403783.1 hypothetical protein -
  QMG94_RS14405 (T2313_2748) - 2747507..2747968 (-) 462 WP_001209480.1 sigma-E factor regulatory protein RseB domain-containing protein -
  QMG94_RS14410 (T2313_2749) - 2747965..2748261 (-) 297 WP_001266133.1 DUF4406 domain-containing protein -
  QMG94_RS14415 (T2313_2750) - 2748258..2748650 (-) 393 WP_001040234.1 DUF977 family protein -
  QMG94_RS14420 (T2313_2751) - 2748666..2749391 (-) 726 WP_000450641.1 DUF1627 domain-containing protein -
  QMG94_RS14425 (T2313_2752) - 2749425..2749886 (-) 462 WP_000139444.1 replication protein P -
  QMG94_RS14430 (T2313_2753) - 2749879..2750889 (-) 1011 WP_000729535.1 DUF1376 domain-containing protein -
  QMG94_RS14435 (T2313_2754) - 2750976..2751413 (-) 438 WP_000693932.1 toxin YdaT family protein -
  QMG94_RS14440 (T2313_2755) - 2751410..2751670 (-) 261 WP_001172789.1 YdaS family helix-turn-helix protein -
  QMG94_RS14445 (T2313_2756) - 2751797..2752189 (+) 393 WP_000578360.1 helix-turn-helix domain-containing protein -
  QMG94_RS14450 (T2313_2757) - 2752236..2752595 (-) 360 WP_001022415.1 helix-turn-helix domain-containing protein -
  QMG94_RS14455 (T2313_2758) - 2752598..2752900 (-) 303 WP_000692026.1 type II toxin-antitoxin system HigB family toxin -
  QMG94_RS14460 - 2753236..2753535 (+) 300 WP_012817750.1 hypothetical protein -
  QMG94_RS14465 (T2313_2760) ydfC 2753607..2753825 (+) 219 WP_001171921.1 protein YdfC -
  QMG94_RS14470 (T2313_2762) dicB 2754394..2754582 (+) 189 WP_000449175.1 cell division inhibition protein DicB -
  QMG94_RS14475 - 2754579..2754767 (+) 189 WP_000199475.1 DUF1482 family protein -
  QMG94_RS14480 (T2313_2763) - 2754862..2757312 (+) 2451 WP_000048499.1 exonuclease -
  QMG94_RS14485 (T2313_2764) - 2757380..2757622 (+) 243 WP_000273151.1 DUF4224 domain-containing protein -
  QMG94_RS14490 (T2313_2765) - 2757600..2758619 (+) 1020 WP_001299351.1 tyrosine-type recombinase/integrase -
  QMG94_RS14495 (T2313_2766) yccA 2759027..2759686 (+) 660 WP_000375138.1 FtsH protease modulator YccA -
  QMG94_RS14500 (T2313_2767) tusE 2759777..2760106 (+) 330 WP_000904442.1 sulfurtransferase TusE -
  QMG94_RS14505 (T2313_2768) yccX 2760103..2760381 (-) 279 WP_000048244.1 acylphosphatase -
  QMG94_RS14510 (T2313_2769) rlmI 2760476..2761666 (+) 1191 WP_000116304.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  QMG94_RS14515 (T2313_2770) hspQ 2761724..2762041 (+) 318 WP_001295356.1 heat shock protein HspQ -
  QMG94_RS14520 (T2313_2771) yccU 2762086..2762499 (-) 414 WP_000665217.1 CoA-binding protein -
  QMG94_RS14525 (T2313_2772) yccT 2762672..2763334 (+) 663 WP_000847791.1 DUF2057 family protein -
  QMG94_RS14530 (T2313_2773) mgsA 2763430..2763888 (+) 459 WP_000424181.1 methylglyoxal synthase -
  QMG94_RS14535 (T2313_2774) helD 2763920..2765974 (-) 2055 WP_001297106.1 DNA helicase IV -
  QMG94_RS14540 (T2313_2775) yccF 2766097..2766543 (+) 447 WP_001261235.1 YccF domain-containing protein -
  QMG94_RS14545 (T2313_2776) yccS 2766553..2768715 (+) 2163 WP_000875023.1 YccS family putative transporter -
  QMG94_RS14550 (T2313_2777) sxy/tfoX 2768678..2769307 (-) 630 WP_000839153.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  QMG94_RS14555 (T2313_2778) sulA 2769526..2770035 (+) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  QMG94_RS14560 (T2313_2779) ompA 2770392..2771432 (+) 1041 WP_000750416.1 porin OmpA -
  QMG94_RS14565 (T2313_2780) matP 2771507..2771959 (-) 453 WP_000877161.1 macrodomain Ter protein MatP -
  QMG94_RS14570 (T2313_2781) ycbZ 2772145..2773905 (+) 1761 WP_000156528.1 Lon protease family protein -
  QMG94_RS14575 (T2313_2782) fabA 2773974..2774492 (+) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  QMG94_RS14580 (T2313_2783) rmf 2774562..2774729 (-) 168 WP_000828648.1 ribosome modulation factor -
  QMG94_RS14585 (T2313_2784) pqiC 2774985..2775548 (-) 564 WP_000759122.1 membrane integrity-associated transporter subunit PqiC -
  QMG94_RS14590 (T2313_2785) pqiB 2775545..2777185 (-) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  QMG94_RS14595 (T2313_2786) pqiA 2777190..2778443 (-) 1254 WP_000333174.1 membrane integrity-associated transporter subunit PqiA -
  QMG94_RS14600 (T2313_2787) uup 2778573..2780480 (-) 1908 WP_000053122.1 ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 209 a.a.        Molecular weight: 24147.02 Da        Isoelectric Point: 9.2180

>NTDB_id=99772 QMG94_RS14550 WP_000839153.1 2768678..2769307(-) (sxy/tfoX) [Escherichia coli strain 2313]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=99772 QMG94_RS14550 WP_000839153.1 2768678..2769307(-) (sxy/tfoX) [Escherichia coli strain 2313]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA

Domains

Predicted by InterproScan.

TfoX N-terminal domain (TfoX_N)

(14-106)

TfoX C-terminal domain (TfoX_C)

(116-194)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

100

100

1

Multiple sequence alignment