Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   ABC811_RS07660 Genome accession   NZ_CP155535
Coordinates   1484606..1484755 (-) Length   49 a.a.
NCBI ID   WP_001818346.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain PJ755/1     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
IScluster/Tn 1485622..1487497 1484606..1484755 flank 867


Gene organization within MGE regions


Location: 1484606..1487497
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABC811_RS07660 (ABC811_07655) cipB 1484606..1484755 (-) 150 WP_001818346.1 bacteriocin-like peptide BlpO Regulator
  ABC811_RS07665 (ABC811_07660) blpN 1484999..1485202 (-) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  ABC811_RS07670 (ABC811_07665) blpM 1485218..1485472 (-) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  ABC811_RS07680 (ABC811_07675) - 1486683..1487497 (+) 815 Protein_1519 IS5-like element IS1515 family transposase -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5134.91 Da        Isoelectric Point: 3.9133

>NTDB_id=997329 ABC811_RS07660 WP_001818346.1 1484606..1484755(-) (cipB) [Streptococcus pneumoniae strain PJ755/1]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=997329 ABC811_RS07660 WP_001818346.1 1484606..1484755(-) (cipB) [Streptococcus pneumoniae strain PJ755/1]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51

Multiple sequence alignment