Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   ABC814_RS02640 Genome accession   NZ_CP155533
Coordinates   507715..507864 (+) Length   49 a.a.
NCBI ID   WP_001818346.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain Spn1439-106     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
IScluster/Tn 505067..506848 507715..507864 flank 867


Gene organization within MGE regions


Location: 505067..507864
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABC814_RS02620 (ABC814_02620) - 505067..505881 (+) 815 Protein_515 IS5-like element IS1515 family transposase -
  ABC814_RS02625 (ABC814_02625) - 506042..506848 (+) 807 Protein_516 IS5 family transposase -
  ABC814_RS02630 (ABC814_02630) blpM 506998..507252 (+) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  ABC814_RS02635 (ABC814_02635) blpN 507268..507471 (+) 204 WP_001099491.1 two-peptide bacteriocin subunit BlpN -
  ABC814_RS02640 (ABC814_02640) cipB 507715..507864 (+) 150 WP_001818346.1 bacteriocin-like peptide BlpO Regulator

Sequence


Protein


Download         Length: 49 a.a.        Molecular weight: 5134.91 Da        Isoelectric Point: 3.9133

>NTDB_id=997156 ABC814_RS02640 WP_001818346.1 507715..507864(+) (cipB) [Streptococcus pneumoniae strain Spn1439-106]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=997156 ABC814_RS02640 WP_001818346.1 507715..507864(+) (cipB) [Streptococcus pneumoniae strain Spn1439-106]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51


Multiple sequence alignment