Detailed information    

insolico Bioinformatically predicted

Overview

Name   comZ   Type   Regulator
Locus tag   AAHT64_RS14290 Genome accession   NZ_CP155054
Coordinates   2767775..2767966 (-) Length   63 a.a.
NCBI ID   WP_003224559.1    Uniprot ID   G4NWD2
Organism   Bacillus subtilis subsp. subtilis strain R38     
Function   repression of comG operon (predicted from homology)   
Competence regulation

Genomic Context

Location: 2762775..2772966
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAHT64_RS14265 (AAHT64_14265) appD 2763100..2764086 (-) 987 WP_003232965.1 oligopeptide ABC transporter ATP-binding protein AppD -
  AAHT64_RS14270 (AAHT64_14270) yjaZ 2764278..2765063 (-) 786 WP_003232967.1 DUF2268 domain-containing protein -
  AAHT64_RS14275 (AAHT64_14275) fabF 2765139..2766380 (-) 1242 WP_003244890.1 beta-ketoacyl-ACP synthase II -
  AAHT64_RS14280 (AAHT64_14280) fabH 2766403..2767341 (-) 939 WP_003232971.1 beta-ketoacyl-ACP synthase III -
  AAHT64_RS14285 (AAHT64_14285) yjzB 2767506..2767745 (+) 240 WP_003232972.1 spore coat protein YjzB -
  AAHT64_RS14290 (AAHT64_14290) comZ 2767775..2767966 (-) 192 WP_003224559.1 ComG operon transcriptional repressor ComZ Regulator
  AAHT64_RS14295 (AAHT64_14295) med 2767981..2768934 (-) 954 WP_003245494.1 transcriptional regulator Med Regulator
  AAHT64_RS14300 (AAHT64_14300) - 2769025..2769582 (-) 558 WP_003232974.1 hypothetical protein -
  AAHT64_RS14305 (AAHT64_14305) - 2769664..2770398 (-) 735 WP_003245223.1 hypothetical protein -
  AAHT64_RS14310 (AAHT64_14310) yjzD 2770647..2770832 (+) 186 WP_003245236.1 DUF2929 domain-containing protein -
  AAHT64_RS14315 (AAHT64_14315) yjzC 2770878..2771057 (-) 180 WP_003245356.1 YjzC family protein -
  AAHT64_RS14320 (AAHT64_14320) argF 2771143..2772102 (-) 960 WP_003232980.1 ornithine carbamoyltransferase -

Sequence

Protein


Download         Length: 63 a.a.        Molecular weight: 7214.27 Da        Isoelectric Point: 4.2564

>NTDB_id=995867 AAHT64_RS14290 WP_003224559.1 2767775..2767966(-) (comZ) [Bacillus subtilis subsp. subtilis strain R38]
MQHEKSLEFLQIAMKYLPEAKEQLEKSGIELSMEAIQPFMNLFTTVMAEAYELGKSDAKSETE

Nucleotide


Download         Length: 192 bp        

>NTDB_id=995867 AAHT64_RS14290 WP_003224559.1 2767775..2767966(-) (comZ) [Bacillus subtilis subsp. subtilis strain R38]
ATGCAGCACGAAAAATCACTTGAATTCTTGCAAATTGCCATGAAATATCTCCCTGAAGCGAAAGAACAGCTTGAGAAATC
AGGCATTGAGCTCTCAATGGAGGCCATCCAGCCGTTTATGAATCTATTTACAACGGTAATGGCGGAAGCTTATGAGCTTG
GCAAGTCTGACGCTAAATCTGAAACAGAATAA

Domains

Predicted by InterproScan.

ComZ (ComZ)

(4-58)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4NWD2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comZ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment