Detailed information
Bioinformatically predicted
Overview
| Name | nucA/comI | Type | Machinery gene |
| Locus tag | AAVC46_RS04325 | Genome accession | NZ_CP154913 |
| Coordinates | 845719..846099 (+) | Length | 126 a.a. |
| NCBI ID | WP_060596689.1 | Uniprot ID | - |
| Organism | Bacillus pumilus strain FUA2119 | ||
| Function | cleavage of dsDNA into ssDNA (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 819171..850507 | 845719..846099 | within | 0 |
Gene organization within MGE regions
Location: 819171..850507
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AAVC46_RS04190 (AAVC46_04190) | - | 819171..819644 (+) | 474 | WP_099725746.1 | antitoxin YezG family protein | - |
| AAVC46_RS04195 (AAVC46_04195) | - | 819882..820268 (-) | 387 | Protein_817 | macro domain-containing protein | - |
| AAVC46_RS04200 (AAVC46_04200) | - | 820382..820924 (+) | 543 | WP_334749228.1 | GNAT family N-acetyltransferase | - |
| AAVC46_RS04205 (AAVC46_04205) | - | 821065..821643 (+) | 579 | WP_345821482.1 | undecaprenyl-diphosphatase | - |
| AAVC46_RS04210 (AAVC46_04210) | - | 821696..822067 (-) | 372 | WP_034660752.1 | iron chaperone | - |
| AAVC46_RS04215 (AAVC46_04215) | - | 822562..822807 (-) | 246 | WP_034660753.1 | hypothetical protein | - |
| AAVC46_RS04220 (AAVC46_04220) | - | 823248..823901 (+) | 654 | WP_034660754.1 | CotZ-related putative spore coat protein | - |
| AAVC46_RS04225 (AAVC46_04225) | - | 823976..824320 (+) | 345 | WP_034660755.1 | S-Ena type endospore appendage | - |
| AAVC46_RS04230 (AAVC46_04230) | - | 824365..825177 (+) | 813 | WP_345821483.1 | collagen-like protein | - |
| AAVC46_RS04235 (AAVC46_04235) | - | 825435..826547 (+) | 1113 | WP_345821485.1 | tetratricopeptide repeat protein | - |
| AAVC46_RS04240 (AAVC46_04240) | - | 827009..827245 (+) | 237 | WP_095285201.1 | hypothetical protein | - |
| AAVC46_RS04245 (AAVC46_04245) | - | 827273..827965 (-) | 693 | WP_345821487.1 | YoaK family protein | - |
| AAVC46_RS04250 (AAVC46_04250) | - | 828000..829865 (-) | 1866 | WP_345821959.1 | DNA ligase D | - |
| AAVC46_RS04255 (AAVC46_04255) | - | 829980..830828 (+) | 849 | WP_345821488.1 | Ku protein | - |
| AAVC46_RS04260 (AAVC46_04260) | - | 831007..831450 (-) | 444 | WP_095285204.1 | DUF2188 domain-containing protein | - |
| AAVC46_RS04265 (AAVC46_04265) | - | 831611..832084 (+) | 474 | WP_106037251.1 | VOC family protein | - |
| AAVC46_RS04270 (AAVC46_04270) | - | 832133..832546 (+) | 414 | WP_334749237.1 | Rrf2 family transcriptional regulator | - |
| AAVC46_RS04275 (AAVC46_04275) | - | 832678..833529 (+) | 852 | WP_095285207.1 | SDR family oxidoreductase | - |
| AAVC46_RS04280 (AAVC46_04280) | - | 833719..834435 (+) | 717 | WP_345821960.1 | (Fe-S)-binding protein | - |
| AAVC46_RS04285 (AAVC46_04285) | - | 834457..835878 (+) | 1422 | WP_345821494.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
| AAVC46_RS04290 (AAVC46_04290) | - | 835878..836600 (+) | 723 | WP_307499670.1 | lactate utilization protein C | - |
| AAVC46_RS04295 (AAVC46_04295) | - | 836745..837653 (+) | 909 | WP_095285210.1 | DMT family transporter | - |
| AAVC46_RS04300 (AAVC46_04300) | - | 837666..837857 (-) | 192 | WP_060596417.1 | hypothetical protein | - |
| AAVC46_RS04305 (AAVC46_04305) | - | 837968..840184 (+) | 2217 | WP_345821499.1 | RNA ligase | - |
| AAVC46_RS04310 (AAVC46_04310) | - | 840608..841186 (+) | 579 | WP_034660763.1 | TetR/AcrR family transcriptional regulator | - |
| AAVC46_RS04315 (AAVC46_04315) | - | 841208..844351 (+) | 3144 | WP_345821500.1 | bifunctional cytochrome P450/NADPH--P450 reductase | - |
| AAVC46_RS04320 (AAVC46_04320) | - | 844542..845450 (+) | 909 | WP_095285213.1 | trypsin-like serine protease | - |
| AAVC46_RS04325 (AAVC46_04325) | nucA/comI | 845719..846099 (+) | 381 | WP_060596689.1 | NucA/NucB deoxyribonuclease domain-containing protein | Machinery gene |
| AAVC46_RS04330 (AAVC46_04330) | - | 846247..847095 (+) | 849 | WP_345821501.1 | STAS domain-containing protein | - |
| AAVC46_RS04335 (AAVC46_04335) | - | 847129..847671 (-) | 543 | WP_345821503.1 | IseA DL-endopeptidase inhibitor family protein | - |
| AAVC46_RS04340 (AAVC46_04340) | - | 847966..848403 (+) | 438 | WP_034660769.1 | hypothetical protein | - |
| AAVC46_RS04345 (AAVC46_04345) | lexA | 848451..849071 (-) | 621 | WP_003212311.1 | transcriptional repressor LexA | - |
| AAVC46_RS04350 (AAVC46_04350) | yneA | 849231..849542 (+) | 312 | WP_034660770.1 | cell division suppressor protein YneA | - |
| AAVC46_RS04355 (AAVC46_04355) | - | 849560..850207 (+) | 648 | WP_307499674.1 | recombinase family protein | - |
| AAVC46_RS04360 (AAVC46_04360) | - | 850277..850507 (+) | 231 | WP_034660771.1 | DUF896 domain-containing protein | - |
Sequence
Protein
Download Length: 126 a.a. Molecular weight: 13796.47 Da Isoelectric Point: 8.4984
>NTDB_id=995302 AAVC46_RS04325 WP_060596689.1 845719..846099(+) (nucA/comI) [Bacillus pumilus strain FUA2119]
MGTLLGGFGEKHAAKGADRYDHVIQFPKERYPETGSHIQEAIRKGHSDVCTIDRNGADARRQESLKGIPTKPGFDRDEWP
MAVCLEGGKGASVQYVSPSDNRGAGSWVGHQISSYPDGKRILFIVK
MGTLLGGFGEKHAAKGADRYDHVIQFPKERYPETGSHIQEAIRKGHSDVCTIDRNGADARRQESLKGIPTKPGFDRDEWP
MAVCLEGGKGASVQYVSPSDNRGAGSWVGHQISSYPDGKRILFIVK
Nucleotide
Download Length: 381 bp
>NTDB_id=995302 AAVC46_RS04325 WP_060596689.1 845719..846099(+) (nucA/comI) [Bacillus pumilus strain FUA2119]
ATGGGCACGTTGTTAGGTGGATTTGGGGAGAAACATGCGGCAAAAGGTGCGGATCGATATGATCATGTCATTCAATTTCC
AAAGGAACGGTACCCTGAAACAGGCAGCCATATTCAAGAAGCCATTCGAAAAGGGCATTCAGATGTGTGTACGATAGACC
GAAATGGAGCAGATGCCCGCAGGCAAGAATCATTAAAAGGAATTCCGACTAAACCTGGCTTTGACCGGGATGAGTGGCCG
ATGGCGGTTTGTCTTGAGGGAGGAAAAGGTGCGAGTGTTCAATATGTCAGCCCATCTGATAATAGGGGAGCAGGCTCATG
GGTTGGACACCAGATTAGCAGTTATCCTGATGGGAAAAGAATTTTATTTATTGTGAAATAA
ATGGGCACGTTGTTAGGTGGATTTGGGGAGAAACATGCGGCAAAAGGTGCGGATCGATATGATCATGTCATTCAATTTCC
AAAGGAACGGTACCCTGAAACAGGCAGCCATATTCAAGAAGCCATTCGAAAAGGGCATTCAGATGTGTGTACGATAGACC
GAAATGGAGCAGATGCCCGCAGGCAAGAATCATTAAAAGGAATTCCGACTAAACCTGGCTTTGACCGGGATGAGTGGCCG
ATGGCGGTTTGTCTTGAGGGAGGAAAAGGTGCGAGTGTTCAATATGTCAGCCCATCTGATAATAGGGGAGCAGGCTCATG
GGTTGGACACCAGATTAGCAGTTATCCTGATGGGAAAAGAATTTTATTTATTGTGAAATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| nucA/comI | Bacillus subtilis subsp. subtilis str. 168 |
57.983 |
94.444 |
0.548 |