Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   AAYR28_RS14610 Genome accession   NZ_CP154909
Coordinates   2825630..2825770 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus safensis strain FUA2117     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2820630..2830770
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAYR28_RS14585 (AAYR28_14585) - 2820895..2821284 (-) 390 WP_024423321.1 hotdog fold thioesterase -
  AAYR28_RS14590 (AAYR28_14590) comA 2821308..2821949 (-) 642 WP_034282566.1 response regulator transcription factor Regulator
  AAYR28_RS14595 (AAYR28_14595) comP 2822030..2824342 (-) 2313 WP_120207602.1 ATP-binding protein Regulator
  AAYR28_RS14600 (AAYR28_14600) comX 2824400..2824567 (-) 168 WP_080696376.1 competence pheromone ComX -
  AAYR28_RS14605 (AAYR28_14605) - 2824564..2825478 (-) 915 WP_034282569.1 polyprenyl synthetase family protein -
  AAYR28_RS14610 (AAYR28_14610) degQ 2825630..2825770 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  AAYR28_RS14615 (AAYR28_14615) - 2826276..2826632 (+) 357 WP_034282571.1 hypothetical protein -
  AAYR28_RS14620 (AAYR28_14620) - 2826668..2827894 (-) 1227 WP_061110020.1 HDOD domain-containing protein -
  AAYR28_RS14625 (AAYR28_14625) - 2828032..2829504 (-) 1473 WP_041115814.1 nicotinate phosphoribosyltransferase -
  AAYR28_RS14630 (AAYR28_14630) - 2829522..2830073 (-) 552 WP_024425949.1 isochorismatase family cysteine hydrolase -
  AAYR28_RS14635 (AAYR28_14635) - 2830134..2830541 (-) 408 WP_034282575.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=995205 AAYR28_RS14610 WP_003213123.1 2825630..2825770(-) (degQ) [Bacillus safensis strain FUA2117]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=995205 AAYR28_RS14610 WP_003213123.1 2825630..2825770(-) (degQ) [Bacillus safensis strain FUA2117]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATCAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment