Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   AAVC22_RS15730 Genome accession   NZ_CP154902
Coordinates   3151145..3151285 (+) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus paralicheniformis strain FUA2150     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3146145..3156285
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAVC22_RS15705 (AAVC22_15710) - 3146246..3146647 (+) 402 WP_026580054.1 YueI family protein -
  AAVC22_RS15710 (AAVC22_15715) - 3146833..3147384 (+) 552 WP_020452795.1 isochorismatase family cysteine hydrolase -
  AAVC22_RS15715 (AAVC22_15720) - 3147462..3148871 (+) 1410 WP_229029889.1 nicotinate phosphoribosyltransferase -
  AAVC22_RS15720 (AAVC22_15725) - 3149049..3150269 (+) 1221 WP_035337594.1 HDOD domain-containing protein -
  AAVC22_RS15725 (AAVC22_15730) - 3150312..3150659 (-) 348 WP_223254849.1 hypothetical protein -
  AAVC22_RS15730 (AAVC22_15735) degQ 3151145..3151285 (+) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  AAVC22_RS15735 (AAVC22_15740) - 3151471..3152382 (+) 912 WP_035337591.1 polyprenyl synthetase family protein -
  AAVC22_RS15740 (AAVC22_15745) comX 3152354..3152524 (+) 171 WP_020452790.1 competence pheromone ComX -
  AAVC22_RS15745 (AAVC22_15750) comP 3152545..3154860 (+) 2316 WP_020452789.1 ATP-binding protein Regulator
  AAVC22_RS15750 (AAVC22_15755) comA 3154947..3155585 (+) 639 WP_003184849.1 response regulator transcription factor Regulator
  AAVC22_RS15755 (AAVC22_15760) - 3155602..3155991 (+) 390 WP_009329508.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=995017 AAVC22_RS15730 WP_003184860.1 3151145..3151285(+) (degQ) [Bacillus paralicheniformis strain FUA2150]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=995017 AAVC22_RS15730 WP_003184860.1 3151145..3151285(+) (degQ) [Bacillus paralicheniformis strain FUA2150]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P69890

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652

Multiple sequence alignment