Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   AAYR26_RS12095 Genome accession   NZ_CP154901
Coordinates   2281326..2281502 (-) Length   58 a.a.
NCBI ID   WP_003183444.1    Uniprot ID   -
Organism   Bacillus licheniformis strain FUA2146     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2276326..2286502
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAYR26_RS12050 (AAYR26_12060) comGE 2276661..2277008 (+) 348 WP_009327907.1 competence type IV pilus minor pilin ComGE -
  AAYR26_RS12055 (AAYR26_12065) comGF 2277034..2277405 (+) 372 WP_003183461.1 competence type IV pilus minor pilin ComGF -
  AAYR26_RS12060 (AAYR26_12070) comGG 2277418..2277783 (+) 366 WP_003183459.1 competence type IV pilus minor pilin ComGG -
  AAYR26_RS12065 (AAYR26_12075) - 2277872..2278054 (+) 183 WP_003183456.1 YqzE family protein -
  AAYR26_RS12070 (AAYR26_12080) - 2278078..2278365 (-) 288 WP_223307118.1 YqzG/YhdC family protein -
  AAYR26_RS12075 (AAYR26_12085) tapA 2278675..2279403 (+) 729 WP_003183451.1 amyloid fiber anchoring/assembly protein TapA -
  AAYR26_RS12080 (AAYR26_12090) - 2279400..2279984 (+) 585 WP_003183449.1 signal peptidase I -
  AAYR26_RS12085 (AAYR26_12095) - 2280058..2280852 (+) 795 WP_003183447.1 TasA family protein -
  AAYR26_RS12090 (AAYR26_12100) sinR 2280957..2281292 (-) 336 WP_006637528.1 helix-turn-helix domain-containing protein Regulator
  AAYR26_RS12095 (AAYR26_12105) sinI 2281326..2281502 (-) 177 WP_003183444.1 anti-repressor SinI family protein Regulator
  AAYR26_RS12100 (AAYR26_12110) - 2281693..2282487 (-) 795 WP_003183441.1 YqhG family protein -
  AAYR26_RS12105 (AAYR26_12115) - 2282494..2284173 (-) 1680 WP_003183439.1 SNF2-related protein -
  AAYR26_RS12110 (AAYR26_12120) gcvT 2284766..2285860 (+) 1095 WP_003183436.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence


Protein


Download         Length: 58 a.a.        Molecular weight: 6724.47 Da        Isoelectric Point: 4.7616

>NTDB_id=994935 AAYR26_RS12095 WP_003183444.1 2281326..2281502(-) (sinI) [Bacillus licheniformis strain FUA2146]
MNKDKNEKEELDEEWTDLIKHALEQGISPEEIRIFLNLGKKSSNPSTSIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=994935 AAYR26_RS12095 WP_003183444.1 2281326..2281502(-) (sinI) [Bacillus licheniformis strain FUA2146]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGACTTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGAAATACGTATTTTTCTCAATTTGGGAAAGAAGTCTTCAAATCCTTCCACATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

51.724

100

0.517


Multiple sequence alignment