Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   AAYR26_RS08240 Genome accession   NZ_CP154901
Coordinates   1578773..1578913 (+) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus licheniformis strain FUA2146     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 1573773..1583913
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAYR26_RS08215 (AAYR26_08225) - 1573874..1574275 (+) 402 WP_003184870.1 YueI family protein -
  AAYR26_RS08220 (AAYR26_08230) - 1574460..1575011 (+) 552 WP_003184868.1 isochorismatase family cysteine hydrolase -
  AAYR26_RS08225 (AAYR26_08235) - 1575029..1576498 (+) 1470 WP_003184866.1 nicotinate phosphoribosyltransferase -
  AAYR26_RS08230 (AAYR26_08240) - 1576677..1577897 (+) 1221 WP_003184864.1 HDOD domain-containing protein -
  AAYR26_RS08235 (AAYR26_08245) - 1577940..1578287 (-) 348 WP_231105863.1 SDR family oxidoreductase -
  AAYR26_RS08240 (AAYR26_08250) degQ 1578773..1578913 (+) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  AAYR26_RS08245 (AAYR26_08255) - 1579102..1579983 (+) 882 WP_009329511.1 polyprenyl synthetase family protein -
  AAYR26_RS08250 (AAYR26_08260) comX 1579987..1580160 (+) 174 WP_009329510.1 competence pheromone ComX -
  AAYR26_RS08255 (AAYR26_08265) comP 1580162..1582462 (+) 2301 WP_009329509.1 ATP-binding protein Regulator
  AAYR26_RS08260 (AAYR26_08270) comA 1582549..1583187 (+) 639 WP_003184849.1 response regulator transcription factor Regulator
  AAYR26_RS08265 (AAYR26_08275) - 1583204..1583593 (+) 390 WP_009329508.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=994918 AAYR26_RS08240 WP_003184860.1 1578773..1578913(+) (degQ) [Bacillus licheniformis strain FUA2146]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=994918 AAYR26_RS08240 WP_003184860.1 1578773..1578913(+) (degQ) [Bacillus licheniformis strain FUA2146]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB P69890

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652


Multiple sequence alignment