Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | AAVC70_RS06175 | Genome accession | NZ_CP154898 |
| Coordinates | 1001139..1001279 (-) | Length | 46 a.a. |
| NCBI ID | WP_013353398.1 | Uniprot ID | P06532 |
| Organism | Bacillus amyloliquefaciens strain Fad 97 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 996139..1006279
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AAVC70_RS06150 (AAVC70_06150) | - | 996220..998232 (-) | 2013 | Protein_1085 | histidine kinase | - |
| AAVC70_RS06160 (AAVC70_06160) | - | 999592..999894 (-) | 303 | WP_345816382.1 | hypothetical protein | - |
| AAVC70_RS06165 (AAVC70_06165) | comX | 999917..1000093 (-) | 177 | WP_013353396.1 | competence pheromone ComX | - |
| AAVC70_RS06170 (AAVC70_06170) | - | 1000112..1000987 (-) | 876 | WP_013353397.1 | polyprenyl synthetase family protein | - |
| AAVC70_RS06175 (AAVC70_06175) | degQ | 1001139..1001279 (-) | 141 | WP_013353398.1 | degradation enzyme regulation protein DegQ | Regulator |
| AAVC70_RS06180 (AAVC70_06180) | - | 1001744..1002085 (+) | 342 | WP_013353399.1 | hypothetical protein | - |
| AAVC70_RS06185 (AAVC70_06185) | - | 1002092..1003315 (-) | 1224 | WP_013353400.1 | EAL and HDOD domain-containing protein | - |
| AAVC70_RS06190 (AAVC70_06190) | - | 1003445..1004911 (-) | 1467 | WP_014472199.1 | nicotinate phosphoribosyltransferase | - |
| AAVC70_RS06195 (AAVC70_06195) | - | 1004929..1005480 (-) | 552 | WP_013353402.1 | isochorismatase family cysteine hydrolase | - |
| AAVC70_RS06200 (AAVC70_06200) | - | 1005561..1005956 (-) | 396 | WP_013353403.1 | DUF1694 domain-containing protein | - |
| AAVC70_RS06205 (AAVC70_06205) | - | 1006022..1006270 (-) | 249 | WP_013353404.1 | YueH family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5532.37 Da Isoelectric Point: 6.2567
>NTDB_id=994842 AAVC70_RS06175 WP_013353398.1 1001139..1001279(-) (degQ) [Bacillus amyloliquefaciens strain Fad 97]
MEKKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MEKKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=994842 AAVC70_RS06175 WP_013353398.1 1001139..1001279(-) (degQ) [Bacillus amyloliquefaciens strain Fad 97]
GTGGAAAAGAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAAGAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
91.304 |
100 |
0.913 |