Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   AAVD18_RS11775 Genome accession   NZ_CP154893
Coordinates   2223627..2223767 (-) Length   46 a.a.
NCBI ID   WP_013353398.1    Uniprot ID   P06532
Organism   Bacillus amyloliquefaciens strain Fad 11/2     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2218627..2228767
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAVD18_RS11750 (AAVD18_11750) - 2218946..2219329 (-) 384 WP_013353393.1 hotdog fold thioesterase -
  AAVD18_RS11755 (AAVD18_11755) comA 2219351..2219995 (-) 645 WP_014472195.1 response regulator transcription factor Regulator
  AAVD18_RS11760 (AAVD18_11760) comP 2220076..2222382 (-) 2307 WP_013353395.1 histidine kinase Regulator
  AAVD18_RS11765 (AAVD18_11765) comX 2222405..2222581 (-) 177 WP_013353396.1 competence pheromone ComX -
  AAVD18_RS11770 (AAVD18_11770) - 2222600..2223475 (-) 876 WP_013353397.1 polyprenyl synthetase family protein -
  AAVD18_RS11775 (AAVD18_11775) degQ 2223627..2223767 (-) 141 WP_013353398.1 degradation enzyme regulation protein DegQ Regulator
  AAVD18_RS11780 (AAVD18_11780) - 2224232..2224573 (+) 342 WP_013353399.1 hypothetical protein -
  AAVD18_RS11785 (AAVD18_11785) - 2224580..2225792 (-) 1213 Protein_2303 EAL and HDOD domain-containing protein -
  AAVD18_RS11790 (AAVD18_11790) - 2225922..2227388 (-) 1467 WP_014472199.1 nicotinate phosphoribosyltransferase -
  AAVD18_RS11795 (AAVD18_11795) - 2227406..2227957 (-) 552 WP_013353402.1 isochorismatase family cysteine hydrolase -
  AAVD18_RS11800 (AAVD18_11800) - 2228038..2228433 (-) 396 WP_013353403.1 DUF1694 domain-containing protein -
  AAVD18_RS11805 (AAVD18_11805) - 2228499..2228747 (-) 249 WP_013353404.1 YueH family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5532.37 Da        Isoelectric Point: 6.2567

>NTDB_id=994715 AAVD18_RS11775 WP_013353398.1 2223627..2223767(-) (degQ) [Bacillus amyloliquefaciens strain Fad 11/2]
MEKKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=994715 AAVD18_RS11775 WP_013353398.1 2223627..2223767(-) (degQ) [Bacillus amyloliquefaciens strain Fad 11/2]
GTGGAAAAGAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P06532

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

91.304

100

0.913

Multiple sequence alignment