Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   EQB46_RS02745 Genome accession   NZ_LR129843
Coordinates   496363..496512 (+) Length   49 a.a.
NCBI ID   WP_001808912.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain 180-2 isolate 180-2     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 491363..501512
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQB46_RS02715 blpC 491674..491829 (-) 156 WP_000358813.1 quorum-sensing system pheromone BlpC -
  EQB46_RS02720 - 491886..493247 (-) 1362 WP_001069092.1 bacteriocin secretion accessory protein -
  EQB46_RS12045 comA/nlmT 493258..493746 (-) 489 WP_307774349.1 ATP-binding cassette domain-containing protein Regulator
  EQB46_RS12050 comA/nlmT 493730..494170 (-) 441 WP_001808911.1 ATP-binding cassette domain-containing protein Regulator
  EQB46_RS12055 comA/nlmT 494160..494885 (-) 726 WP_167750760.1 ABC transporter transmembrane domain-containing protein Regulator
  EQB46_RS12060 comA/nlmT 494830..495417 (-) 588 WP_000205166.1 cysteine peptidase family C39 domain-containing protein Regulator
  EQB46_RS02735 blpI 495699..495896 (+) 198 WP_001093258.1 bacteriocin-like peptide BlpI -
  EQB46_RS02745 cipB 496363..496512 (+) 150 WP_001808912.1 bacteriocin-like peptide BlpO Regulator
  EQB46_RS02750 - 496616..496735 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  EQB46_RS02760 - 497521..497904 (+) 384 WP_000877381.1 hypothetical protein -
  EQB46_RS02765 - 497956..498645 (+) 690 WP_000760526.1 CPBP family intramembrane glutamic endopeptidase -
  EQB46_RS02770 blpZ 498687..498935 (+) 249 WP_000276499.1 immunity protein BlpZ -
  EQB46_RS02775 - 498965..499576 (+) 612 WP_000394047.1 CPBP family intramembrane glutamic endopeptidase -
  EQB46_RS02780 ccrZ 499737..500531 (+) 795 WP_000363002.1 cell cycle regulator CcrZ -
  EQB46_RS02785 trmB 500528..501163 (+) 636 WP_001266080.1 tRNA (guanosine(46)-N7)-methyltransferase TrmB -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5150.86 Da        Isoelectric Point: 3.7098

>NTDB_id=993866 EQB46_RS02745 WP_001808912.1 496363..496512(+) (cipB) [Streptococcus pneumoniae strain 180-2 isolate 180-2]
MNTKMMSQFSVMDNEMLACVEGGDIDWGREISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=993866 EQB46_RS02745 WP_001808912.1 496363..496512(+) (cipB) [Streptococcus pneumoniae strain 180-2 isolate 180-2]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAGAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-41)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51