Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   EQB42_RS02615 Genome accession   NZ_LR129841
Coordinates   487520..487669 (+) Length   49 a.a.
NCBI ID   WP_001813641.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain 947 isolate 947     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 482520..492669
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQB42_RS02575 blpU 484384..484614 (+) 231 WP_001093268.1 bacteriocin-like peptide BlpU -
  EQB42_RS02580 - 484617..484736 (+) 120 WP_000346298.1 PncF family bacteriocin immunity protein -
  EQB42_RS02585 - 485033..485197 (+) 165 WP_000727118.1 hypothetical protein -
  EQB42_RS02590 - 485194..485598 (+) 405 WP_000846944.1 hypothetical protein -
  EQB42_RS02595 - 485796..486601 (+) 806 Protein_480 IS5 family transposase -
  EQB42_RS02600 blpM 486803..487057 (+) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  EQB42_RS02605 blpN 487073..487276 (+) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  EQB42_RS02615 cipB 487520..487669 (+) 150 WP_001813641.1 bacteriocin-like peptide BlpO Regulator
  EQB42_RS02620 - 487773..487892 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  EQB42_RS02630 - 488678..489061 (+) 384 WP_000877378.1 hypothetical protein -
  EQB42_RS02635 - 489113..489802 (+) 690 WP_000760541.1 CPBP family intramembrane glutamic endopeptidase -
  EQB42_RS02640 blpZ 489844..490077 (+) 234 WP_000276498.1 immunity protein BlpZ -
  EQB42_RS02650 - 490228..490839 (+) 612 WP_000394045.1 CPBP family intramembrane glutamic endopeptidase -
  EQB42_RS02655 ccrZ 491000..491794 (+) 795 WP_127820893.1 cell cycle regulator CcrZ -
  EQB42_RS02660 trmB 491791..492426 (+) 636 WP_001266078.1 tRNA (guanosine(46)-N7)-methyltransferase TrmB -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5164.93 Da        Isoelectric Point: 3.9133

>NTDB_id=993751 EQB42_RS02615 WP_001813641.1 487520..487669(+) (cipB) [Streptococcus pneumoniae strain 947 isolate 947]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCTAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=993751 EQB42_RS02615 WP_001813641.1 487520..487669(+) (cipB) [Streptococcus pneumoniae strain 947 isolate 947]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTACAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-41)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

48.98

100

0.49